Title of Invention	"HUMAN MONOCLONAL ANTIBODIES AGAINST HUMAN IL-4"
Abstract	Antibodies which are specific for human interleukin-4 and their use in the treatment of IL-4 and/or IgE mediated diseases.

Full Text

HUMAN MONOCLONAL ANTIBODIES AGAINST HUMAN IL-4 The present invention relates to antibodies which are specific for human interleukin-4 (hlL-4). Allergic diseases such as atopic dermatitis, allergic rhinitis, asthma and food allergies are characteristically associated with exacerbated Th2 cell responses to innocuous environmental antigens (allergens). Allergens are captured by antigen presenting cells, processed and presented in the context of MHC Class II molecules to allergen-specific T helper (Th) cells. Allergen specific Th cells belong to the Th2 phenotype and develop from precursor T cells under the influence of interleukin-4 (IL-4). Once Th2 cells are activated, they secrete IL-4 and interleukin-13 (IL-13), which together with surface bound signals induce B cells to switch to IgE producing plasma cells. IgE molecules bind to high affinity FceR on mast cells and, after subsequent encounter with allergen, induce mast cell activation and the release of mediators of allergic reactions. Th2 cytokines also promote the survival of eosinophils and the growth of mast cells which, after degranulation, also release additional Th2 cytokines capable of augmenting IgE production, Th2 cell differentiation and eosinophil survival. Thus, Th2 cells play a pivotal role in the induction and development of allergic responses and therefore, antagonizing their development and/or their effector functions would be an efficient way to intervene in allergic responses. IL-4 and IL-13 share many biological activities due to the fact that both cytokines use the IL-4 receptor (IL-4R)-alpha chain as a component of their respective receptor complexes. IL-13 signals through an heterodimeric complex consisting of an IL-13 binding chain (IL-13Ra1) and the IL-4Ra chain. IL-4 utilizes this IL-4Ra/IL-13Ra1 complex, called type IIIL-4R, as an alternative to the type IIL-4R, consisting of IL-4Ra chain and the common y chain (cy) shared by receptors for IL-2, IL-4, IL-7, IL-9, IL-15 and thymic stromal lymphopoietin (TSLP). Because T cells do not express IL-13Ra1, IL-13 in contrast to IL-4 does not support T cell proliferation and cannot induce the differentiation of naive human Th cells towards the Th2 phenotype (see e.g. J. E. de Vries et al., Encyclopedia of Hormones and related cell regulators, Academic Press, 2002). IL-4 plays a pivotal role in T cell proliferation and thus in the development and maintenance of allergic diseases. IL-4 gene deficient mice or mice lacking IL-4 (see e.g. Kuhn R. et al., Science, 1991 (5032) 707:10) or the downstream signaling factor STAT6 (see e.g. Kaplan M.H. et al., Immunity, 1996 (3) 313-9) do not develop significant numbers of Th2 cells and have reduced IgE responses. We have now found antibodies with a high affinity for human IL-4 and a strong inhibitory potential of IL-4 mediated IgE synthesis by naive human B cells. In one aspect the present invention provides an human IL-4 specific antibody which binds to human IL-4 with a dissociation constant Kd of equal or less than 800 pM, such as e.g. equal or less than 200 pM. In another aspect the present invention provides an antibody having a first domain comprising in sequence the hypervariable regions CDR1, CDR2 and CDR3 and a second domain comprising in sequence the hypervariable regions CDR1', CDR2' and CDR3' selected from the group consisting of an antibody wherein a) said CDR1 has the amino acid sequence Gly-Phe-Thr-Phe-Ser-Ser-Tyr-Ala-Met-His (GFTFSSYAMH), said CDR2 has the amino acid sequence Phe-lle-Trp-Asp-Asp-Gly-Ser-Phe-Lys-Tyr-Tyr-Ala- Glu-Ser-Val-Lys-Gly(FIWDDGSFKYYAESVKG), said CDR3 has the amino acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-lle-Phe (EGSWSPDIF), said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Ser-Arg-Ala (SQGISRA), said CDR2' has the amino acid sequence Asp-Ala-Ser (DAS), said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-lle (FNSYPI), b) said CDR1 has the amino acid sequence Gly-Phe-Thr-Leu-Ser-Ser-Phe-Gly-Met-His (GFTLSSFGMH), said CDR2 has the amino acid sequence Val-lle-Trp-Tyr-Asp-Gly-Ser-Asn-Glu-Tyr-Tyr-Ala-Asp- Ser-Val-Lys-Gly(VIWYDGSNEYYADSVKG), said CDR3 has the amino acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-lle-Phe (EGSWSPDIF), said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Arg-Ser-Ala (SQGIRSA), said CDR2' has the amino acid sequence Asp-Ala-Ser (DAS), said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-Val (FNSYPV), c) said CDR1 has the amino acid sequence Gly-Phe-Thr-Leu-Ser-Ser-Tyr-GIy-Met-His (GFTLSSYGMH), said CDR2 has the amino acid sequence Val-lle-Trp-Tyr-Asp-Gly-Asn-Asn-Gln-Tyr-Tyr-Ala-Asp- Ser-Val-Lys-Gly(VIWYDGNNQYYADSCKG), said CDR3 has the amino acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-lle-Phe (EGSWSPDIF), said CDR11 has the amino acid sequence Ser-Gln-Gly-lle-Ser-Ser-Tyr (SQGISSY), said CDR2' has the amino acid sequence Asp-Ala-Ser (DAS), said CDR31 has the amino acid sequence Phe-Asn-Ser-Tyr-Pro (FNSYP), d) said CDR1 has the amino acid sequence Gly-Asp-Thr-Phe-Ser-Ser-Tyr-Ala-lle-Ser (GDTFSSYAIS), said CDR2 has the amino acid sequence Gly-lle-lle-lle-Pro-Val-lle-Gly-Thr-Val-Asn-Tyr-Glu-Glu- Arg-Phe-Gln-Asp-Arg(GIIIPVIGTVNYEERFQD). said CDR3 has the amino acid sequence Glu-Glu-Gly-Phe-Leu (EEGFL), said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Ser-Ser-Ala (SQGISSA), said CDR2' has the amino acid sequence Asp-Ala-Ser (DAS), said CDR31 has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-Leu (FNSYPL), e) said CDR1 has the amino acid sequence Gly-Phe-Thr-Phe-Ser-Cys-Cys-Gly-Met-His (GFTFSCCGMH), said CDR2 has the amino acid sequence Val-lle-Trp-Tyr-Asp-Gly-Ser-Asn-Lys-Tyr-Tyr-Ala-Asp- Ser-Val-Lys-Gly(VIWYDGSNKYYADSVKG), said CDR3 has the amino acid sequence Asp-Ser-Ser-Gly-Ser-Phe-Tyr-Glu-Tyr-Phe (DSSGSFYEYF), said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Asn-Ser-Ala (SQGINSA), said CDR2' has the amino acid sequence Asp-Ala-Ser (DAS), said CDR31 has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-Tyr (FNSYPY), and f) said CDR1 has the amino acid sequence Gly-Phe-Thr-Phe-Ser-Gly-Tyr-Gly-Met-His (GFTFSGYGMH), said CDR2 has the amino acid sequence Val-Val-Trp-Tyr-Asp-Gly-Gly-Tyr- Lys- Phe-Tyr-Ala- Asp-Ser-Val-Lys-Gly(WWYDGGYKFYADSVKG), said CDR3 has the amino acid sequence Asp-Ser-Ser-Gly-Ser-Phe-Tyr-Glu-Tyr-Leu (DSSGSFYEYL), said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Ser-Ser-Ala (SQGISSA), said CDR2' has the amino acid sequence Asp-Ala-Ser (DAS), said CDR31 has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-His (FNSYPH). CDR1, CDR2 and CDR3 are part of the amino acid sequence of the heavy chain of such antibody and CDRT, CDR2' and CDR3' are part of the amino acid sequence of the light chain of such antibody. We also have found an antibody comprising: - the amino acid sequence of the heavy chain of a mature polypeptide of SEQ ID NO:1 and the amino acid sequence of the light chain of a mature polypeptide of SEQ ID NO:2, or - the amino acid sequence of the heavy chain of a mature polypeptide of SEQ ID NO:9 and the amino acid sequence of the light chain of a mature polypeptide of SEQ ID NO:10, or - the amino acid sequence of the heavy chain of a mature polypeptide of SEQ ID NO: 17 and the amino acid sequence of the light chain of a mature polypeptide of SEQ ID NO:18, or - the amino acid sequence of the heavy chain of a mature polypeptide of SEQ ID NO:25 and the amino acid sequence of the light chain of a mature polypeptide of SEQ ID NO:26, or - the amino acid sequence of the heavy chain of a mature polypeptide of SEQ ID NO:33 and the amino acid sequence of the light chain of a mature polypeptide of SEQ ID NO:34, or - the amino acid sequence of the heavy chain of a mature polypeptide of SEQ ID NO:41 and the amino acid sequence of the light chain of a mature polypeptide of SEQ ID NO:42. In a further aspect the present invention provides an antibody comprising a) a polypeptide of SEQ ID NO:1 and a polypeptide of SEQ ID NO:2, or b) a polypeptide of SEQ ID NO:9 and a polypeptide of SEQ ID NO:10, or c) a polypeptide of SEQ ID NO: 17 and a polypeptide of SEQ ID NO: 18, or d) a polypeptide of SEQ ID NO:25 and a polypeptide of SEQ ID NO:26, or e) a polypeptide of SEQ ID NO:33 and a polypeptide of SEQ ID NO:34, or f) a polypeptide of SEQ ID NO:41 and a polypeptide of SEQ ID NO:42. We further have found an antibody comprising: - the amino acid sequence of the heavy chain of a polypeptide of SEQ ID NO:1 further containing a leader sequence (= SEQ ID NO:3) and the amino acid sequence of the light chain of a polypeptide of SEQ ID NO:2 further containing a leader sequence (= SEQ ID NO:4), or - the amino acid sequence of the heavy chain of a polypeptide of SEQ ID NO:9 further containing a leader sequence (= SEQ ID NO: 11) and the amino acid sequence of the light chain of a polypeptide of SEQ ID NO:10 further containing a leader sequence (= SEQ ID NO:12), or - the amino acid sequence of the heavy chain of a polypeptide of SEQ ID NO:17 further containing a leader sequence (= SEQ ID NO: 19) and the amino acid sequence of the light chain of a polypeptide of SEQ ID NO: 18 further containing a leader sequence (= SEQ ID NO:20), or - the amino acid sequence of the heavy chain of a polypeptide of SEQ ID NO:25 further containing a leader sequence (= SEQ ID NO:27) and the amino acid sequence of the light chain of a polypeptide of SEQ ID NO:26 further containing a leader sequence (= SEQ ID NO:28), or - the amino acid sequence of the heavy chain of a polypeptide of SEQ ID NO:33 further containing a leader sequence (= SEQ ID NO:35) and the amino acid sequence of the light chain of a polypeptide of SEQ ID NO:34 further containing a leader sequence (= SEQ ID NO:36), or - the amino acid sequence of the heavy chain of a polypeptide of SEQ ID NO:41 further containing a leader sequence (= SEQ ID NO:43) and the amino acid sequence of the light chain of a polypeptide of SEQ ID NO:42 further containing a leader sequence (= SEQ ID NO:44). In a further aspect the present invention provides an antibody comprising a) a polypeptide of SEQ ID NO:3 and a polypeptide of SEQ ID NO:4, or b) a polypeptide of SEQ ID NO:11 and a polypeptide of SEQ ID NO:12. or 5 c) a polypeptide of SEQ ID NO:19 and a polypeptide of SEQ ID NO:20, or d) a polypeptide of SEQ ID NO:27 and a polypeptide of SEQ ID NO:28, or e) a polypeptide of SEQ ID NO:35 and a polypeptide of SEQ ID NO:36, or f) a polypeptide of SEQ ID NO:43 and a polypeptide of SEQ ID NO:44. Antibodies provided by the present invention are hereinafter also designated as "compound(s) of (according to) the present invention". In another aspect the present invention provides a compound of the present invention which is selected from the group consisting of an human IL-4 specific monoclonal antibody (hll_-4 mAb), a fragment thereof and an analog thereof. An hlL-4 mAb is an antibody which specifically recognizes human IL-4, i.e. includes antigen binding sites specific for human IL-4, and which has specifically its CDRs but also other parts of the heavy and light chain derived from human immunoglobulins. The antibody may be of any isotype including lgG1, lgG2, IgGS and lgG4, preferably of isotype lgG1. "A fragment thereof means a part of the heavy and light chain variable sequence of a hlL-4 mAb, which retains the same antigen binding specificity and/or neutralizing ability as the molecule from which the fragments are derived, e.g. a Fab fragment or a F(ab')2 fragment derived from hlL- mAb. A Fab fragment contains the entire light chain and amino terminal portions of the heavy chain; a F(ab")2 fragment is the fragment formed by 2 Fab fragments bound by disulfide bonds. Such fragments can be obtained by conventional means, e.g. cleavage of the monoclonal antibodies with the appropriate proteolytic enzymes, papain and/or pepsin, or by recombinant methods, and the fragments themselves are useful as therapeutic and/or prophylactic agents. "An analog thereof means a hlL-4 mAb with an amino acid sequence which is modified by at least one amino acid outside of the CDR regions, e.g. outside of CDR1, CDR2 and CDRS of the heavy chain or outside of CDR1', CDR2' and CDR3' of the light chain. Said modification includes a chemical modification, a substitution or a rearrangement of one or a few amino acids, i.e. no more than 10 amino acids, which modification permits the amino acid sequence to retain the biological characteristics, e.g. antigen specificity and affinity, of the unmodified sequence. For example silent mutations can be constructed via substitution to create endonuclease restriction sites within or surrounding the CDR regions. 6 An analog may also arise as allelic variation. An "allelic variation or modification" is an alteration in the nucleic acid sequence encoding an antibody of the present invention outside of the CDR regions. Such alterations or modifications may be due to the degeneracies of the genetic code or may be liberately engineered to provide desired characteristics. Such variations or modifications may or may not result in alterations in any encoded amino acid sequence, but retain the biological activities, e.g. antigen specificity and affinity. We have also found polynucleotides encoding compounds of the present invention. In another aspect the present invention provides isolated polynucleotides comprising polynucleotides encoding a compound of the present invention. In another aspect the present invention provides polynucleotides encoding the amino acid sequence of CDR1, CDR2 and CDR3 of a compound of the present invention and polynucleotides encoding the amino acid sequence of CDR1', CDR2' and CDR3' of a compound of the present invention. In another aspect the present invention provides polynucleotides comprising a) a polynucleotide of SEQ ID NO:5 and a polynucleotide of SEQ ID NO:6, or b) a polynucleotide of SEQ ID NO:13 and a polynucleotide of SEQ ID NO:14, or c) a polynucleotide of SEQ ID NO:21 and a polynucleotide of SEQ ID NO:22, or d) a polynucleotide of SEQ ID NO:29 and a polynucleotide of SEQ ID NO:30, or e) a polynucleotide of SEQ ID NO:37 and a polynucleotide of SEQ ID NO:38, or f) a polynucleotide of SEQ ID NO:45 and a polynucleotide of SEQ ID NO:46. In another aspect the present invention provides polynucleotides encoding a) a polypeptide of SEQ ID NO:7 and SEQ ID NO:8, or b) a polypeptide of SEQ ID NO:15 and SEQ ID NO:16, or c) a polypeptide of SEQ ID NO:23 and SEQ ID NO:24, or d) a polypeptide of SEQ ID NO:31 and SEQ ID NO:32, or e) a polypeptide of SEQ ID NO:39 and SEQ ID NO:40, or 0 a polypeptide of SEQ ID NO:47 and SEQ ID NO:48. SEQ ID NO:5 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:1. SEQ ID NO:6 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:2. SEQ ID NO:7 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:3. SEQ ID NO:8 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:4. SEQ ID NO:13 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:9. SEQ ID NO: 14 is a polynucleotide encoding an amino acid sequence of SEQ ID NO: 10. SEQ ID NO: 15 is a polynucleotide encoding an amino acid sequence of SEQ IDNO:11. SEQ ID NO: 16 is a polynucleotide encoding an amino acid sequence of SEQ ID NO: 12. SEQ ID NO:21 is a polynucleotide encoding an amino acid sequence of SEQ ID NO: 17. SEQ ID NO:22 is a polynucleotide encoding an amino acid sequence of SEQ ID NO: 18. SEQ ID NO:23 is a polynucleotide encoding an amino acid sequence of SEQ ID NO: 19. SEQ ID NO:24 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:20. SEQ ID NO:29 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:25. SEQ ID NO:30 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:26. SEQ ID NO:31 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:27. SEQ ID NO:32 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:28. SEQ ID NO:37 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:33. SEQ ID NO:38 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:34. SEQ ID NO:39 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:35. SEQ ID NO:40 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:36. SEQ ID NO:45 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:41. SEQ ID NO:46 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:42. SEQ ID NO:47 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:43. SEQ ID NO:48 is a polynucleotide encoding an amino acid sequence of SEQ ID NO:44. A compound of the present invention may be produced by recombinant DNA techniques. Thus, one or more DNA molecules encoding the antibody, a fragment thereof or an analog thereof may be constructed, placed under appropriate control sequences in an appropriate vector and transferred into a suitable host (organism) for expression. The compound of the present invention may be obtained according, e.g. analogously, to a method as conventional together with the information provided herein, e.g. with the knowledge of the amino acid sequence of the hypervariable and/or variable regions and the polynucleotides encoding these regions. A method for constructing a variable domain gene is e.g. described in EP 239 400 and may be briefly summarized as follows: A replicable expression vector including a suitable promoter operably linked to a polynucleotide sequence of interest, e.g. encoding at least a variable domain of an immunoglobulin heavy or light chain comprising CDRs, is prepared, a suitable cell line is transformed with said expression vector, the transformed cell line is cultured and the corresponding immunoglobulin is obtained. In another aspect the present invention provides an expression vector comprising a polynucleotide encoding a compound of the present invention, e.g. at least one polynucleotide of SEQ ID NO:5, SEQ ID NO: 6, SEQ ID NO:7, SEQ ID No:8, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID No:16, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID No:24, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID No:40, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47 or SEQ ID No:48. Naturally an expression vector can comprise more than one polynucleotide. In another aspect the present invention provides - An expression system comprising a polynucleotide encoding a compound of the present invention wherein said expression system or part thereof is capable of producing a compound of the present invention, e.g. a hll_-4 mAb, when said expression system or part thereof is present in a compatible host cell; and - An isolated host cell comprising an expression system as defined above. Expression vectors, e.g. comprising suitable promoter(s) and genes encoding heavy and light chain constant parts are known, e.g. and are commercially available and include e.g. heavy chain vector lgG1 and light chain vector human kappa. A conventional expression vector or recombinant plasmid may be produced by placing the respective polynucleotide in operative association with conventional regulatory control sequences capable of controlling the replication and expression in, and/or secretion from, a host cell. Regulatory sequences include promoter sequences, e.g. CMV promoter, LCK promoter, and appropriate signal sequences. A selected host cell may be transfected by conventional techniques with the vector of interest to create a transfected host cell, which then may be cultured by conventional techniques to produce the compounds of the present invention. Appropriate cell lines may be found according, e.g. analogously, to a method as conventional. Appropriate hosts are known or may be found according, e.g. analogously, to a method as conventional and include cell cultures or transgenic animals. Suitable host cells or cell lines for the expression of the compounds of the present invention are preferably eukaryotic cells such as e.g. CHO, COS, a fibroblast cell (e.g. 3T3) and myeloid cells among others, preferably a mammalian cell, such as a CHO cell or SP2/0. The compounds of the present invention exhibit pharmacological activity and are therefore useful as Pharmaceuticals. E.g., the compounds of the present invention interfere strongly with the binding of IL-4 to an IL-4 receptor and are herein also referred to as IL-4 blocking or neutralizing compounds of the present invention, including hlL-4 mAb(s). Compounds of the present invention show activity and their affinity can be determined in the TEST:AFFINITY MEASUREMENT as described in Example 1. A compound of the present invention thus shows therapeutic activity against IL-4 and/or IgE mediated diseases, such as - various allergic diseases, e.g. including urticaria, allergic reactions to medication, rhinitis, e.g. allergic rhinitis, conjunctivitis, e.g. rhinoconjunctivitis, dermatitis, e.g. atopic dermatitis, asthma, e.g. atopic asthma and allergic asthma, anaphylactic shock; preferably atopic dermatitis, allergic asthma, allergic rhinitis, allergic rhinoconjunctivitis, such as allergic asthma or atopic dermatitis; - autoimmune diseases, including e.g. Kawasaki disease, Grave's disease, Sjorgen's syndrome, autoimmune lymphoproliferative syndrome, autoimmune haemolytic anemia, autoimmune uveitis, myasthenia gravis, Lupus Erythematosis and Bullous pemphigoid; - disorders of the digestive system in which IL-4 and/or IgE play a role, including e.g. ulcers, gastric inflammation, mucosal inflammation, ulcerative colitis, Crohn's disease, inflammatory bowel disease and other disorders of the digestive system in which IL-4 and/or IgE play a role; - diseases wherein IL-4 and/or IgE are overproduced and considered to contribute to pathology, including e.g. systemic sclerosis (scleroderma), septic arthritis and reactive arthritis. In another aspect the present invention provides a compound of the present invention, e.g. a hlL-4 mAb, for use as a pharmaceutical, e.g. against IL-4 and/or IgE mediated diseases, e.g. allergic diseases, e.g. atopic dermatitis, allergic asthma, allergic rhinitis, preferably atopic dermatitis. In another aspect the present invention provides the use of the present invention of a compound of the present invention which is selected from the group consisting of a hlL-4 mAb, a fragment thereof and an analog thereof. For pharmaceutical use a compound of the present invention includes one or more, preferably one, compounds of the present invention, e.g. a combination of two or more compounds of the present invention. In another aspect the present invention provides the use of a compound of the present invention for the manufacture of a medicament, e.g. a pharmaceutical composition, for the treatment of diseases mediated by IL-4 and/or IgE, e.g. allergic diseases, e.g. allergic rhinoconjunctivitis, atopic dermatitis, allergic asthma, allergic rhinitis, preferably allergic asthma or atopic dermatitis, such as atopic dermatitis. 10 In a further aspect the present invention provides the use of a compound of the present invention for the manufacture of a medicament, e.g. a pharmaceutical composition, for the treatment of a disease as described above, e.g. selected from the group consisting of atopic dermatitis, allergic asthma and allergic rhinitis. In a further aspect the present invention provides a compound of the present invention for the uses as mentioned above, wherein the compound of the present invention is selected from the group consisting of a hlL-4 mAb, a fragment thereof and an analog thereof. It has, for example been determined that the affinity constant of a compound of the present invention, e.g. a hlL-4 mAb, a fragment thereof or an analog thereof, for human IL-4 is equal or less than 800 pM, e.g. is equal or less than 200 pM, such as of about 30 pM to about 200 pM, preferably of about 45 pM to about 170 pM, such as about 100 pM, more preferred about 50 pM, such as about 45 pM. It has, for example also been determined that the affinity constant of a compound of the present invention, e.g. a hlL-4 mAb, a fragment thereof or an analog thereof, for human IL-4 is of 30 pM to 200 pM, preferably of 45 pM to 170 pM, such as 100 pM, more preferred 50 pM, such as 45 pM. It is therefore, indicated that for the treatment of diseases mediated by IL-4, the compounds of the present invention may be administered to larger mammals, for example humans, by similar modes of administration at similar dosages than conventionally used with monoclonal antibodies. In another aspect the present invention provides an antibody which binds to human IL-4 with a dissociation constant of equal or less than 200 pM, e.g. 30 to 200 pM. In a further aspect of the present invention the antibody for the uses as mentioned above is a hlL-4 mAb, a fragment thereof or an analog thereof which binds to human IL-4 with a dissociation constant K In a further aspect the present invention provides a method of treatment of diseases which are mediated by IL-4 and/or IgE, e.g. allergic diseases, e.g. atopic dermatitis, allergic asthma, allergic rhinitis, preferably atopic dermatitis, which treatment comprises administering to a subject in need of such treatment an effective amount of a compound of the present invention; e.g. in the form of a pharmaceutical composition. In a further aspect of the present invention a compound of the present invention is administered in combination with another pharmaceutically active agent either simultaneously or in sequence. Treatment includes treatment and prophylaxis. For such treatment, the appropriate dosage will, of course, vary depending upon, for example, the chemical nature and the pharmacokinetic data of an antibody of the present invention employed, the individual host, the mode of administration and the nature and severity of the conditions being treated. However, in general, for satisfactory results in larger mammals, for example humans, an indicated daily dosage is in the range from, e.g. about, 0.1 ng/kg to, e.g. about, 10 mg/kg, such as from, e.g. about, 100 ng/kg to, e.g. about, 2 mg/kg of a compound of the present invention; conveniently administered, for example, in divided doses up to four times a day. A compound of the present invention may be administered by any conventional route, for example parenterally, e.g. including intravenous, intradermal, intramuscular, subcutaneous, intranasal administration, injectable solutions or suspensions or inhaler powder. In another aspect the present invention provides a pharmaceutical composition comprising a compound of the present invention in association with at least one pharmaceutical excipient, e.g. appropriate carrier and/or diluent, e.g. including fillers, binders, disintegrators, flow conditioners, lubricants, sugars and sweeteners, fragrances, preservatives, stabilizers, wetting agents and/or emulsifiers, solubilizers, salts for regulating osmotic pressure and/or buffers. In another aspect the present invention provides a pharmaceutical composition according to the present invention further comprising another pharmaceutically active agent. Such compositions may be manufactured according, e.g. analogously to a method as conventional, e.g. by mixing, granulating, coating, dissolving or lyophilizing processes. Unit dosage forms may contain, for example, from, e.g. about, 0.5 mg to, e.g. about, 1000 mg, such as 1 mg to about 500 mg. A compound of the present invention may be used for pharmaceutical treatment according to the present invention alone or in combination with one or more other pharmaceutically active agents. Such other pharmaceutically active agents include e.g. other antibodies, e.g. such as antibodies neutralizing IgE, cytokines or cytokine receptors, which are chosen according to the particular condition to be treated. Combinations include fixed combinations, in which two or more pharmaceutically active agents are in the same formulation; kits, in which two or more pharmaceutically active agents in separate formulations are sold in the same package, e.g. with instruction for co-administration; and free combinations in which the pharmaceutically active agents are packaged separately, but instruction for simultaneous or sequential administration are given. In another aspect the present invention also provides a method for diagnosing allergies and other conditions associated with excess IgE production in a human which comprises a) contacting a sample of a biological fluid with an antibody of the present invention, and b) assaying for the occurrence of binding between said antibody and human IL-4. In the following Examples all temperatures are in degrees Celsius (*C) and are unconnected. The following abbreviations are used: FACS buffer PBS, 2% PCS and 0.2% NaN3 PCS fetal calf serum FITC fluoroescein isothiocyanat IC50 inhibitory concentration KLH keyhole limpet hemocyanin mAb monoclonal antibody MIX methotrexate PBS phosphate buffered saline slgD surface Immunoglobulin D rmlL-3 recombinant murine interleukin-3 rhll_-4 recombinant human interleukin-4 rhlL-13 recombinant human interleukin-13 rpm revolutions per minute RPMI Roswell Park Memorial Institute medium RT room temperature TF-buffer 272 mM sucrose, 1 mM MgCI2, 7 mM phosphate buffer pH 7.4 EXAMPLES EXAMPLE 1: a) Antibody production Plasmids encoding the variable regions of the sequence SEQ ID NO: 5 or 7 (= heavy chain) and the sequence SEQ ID NO: 6 or 8 (= light chain) of the antibody are cloned into expression cassettes for human kappa light chains and human lgG1 heavy chains. The specificity determining regions are combined with the necessary elements to generate complete monoclonal antibodies, i.e. promoter, leader sequence and splice donor sites for splicing to the antibody constant region exons that are required for the expression of functional immunoglobulin proteins. The variable region cassettes for the heavy and light chain antibodies, encoding for leader sequences, variable region and 3'- prime splice donor sites for splicing the constant region exons CH1-CH4 and kappa, are transferred into mammalian expression vetors HC (heavy chain vector, human lgG1) and LC (light chain vector, human kappa). The light chain containing plasmid.and the heavy chain containing plasmid are introduced into Sp2/0 cells in a co-transfection approach. E.g. for transfection, cells in exponential growth phase with a viability of about 95% are used. Cells are washed twice with cold TF-buffer and cell concentration is adjusted to 2 x 107 cells/ml in TF-buffer. 0.8 ml cell suspension obtained are mixed with 15 ng each of the heavy chain and light chain plasmid and placed on ice for 10 minutes. Transfection is done by electroporation using the Biorad Gene Pulser (280 V and 25 uF). After electroporation, cells are placed on ice for 15 minutes, transferred into 50 ml cold culture medium and incubated for 1 day at 37" and 5% CO2. For clonal amplification, the G418 resistant cells obtained are cultivated in the presence of 200 nM MTX. An aliquot of the heterogeneous cell pool is seeded into 96-well plates at clonal density of 1 viable cell/well in culture medium containing 200 nM MTX allowing selection of clonal populations of amplified cells. Limiting dilution cloning is applied to generate clonal cell lines after amplification and adaptation to serum-free culture conditions. Cells are seeded into two 96-well plates at a concentration of 0.5 cell/well. Wells are screened microscopically for clonality one day after seeding. Only monoclonal antibodies are used for further testing. The antibody obtained comprises an amino acid sequence of SEQ ID NO:1 and SEQ ID NO:2. b) Affinity measurements Affinity measurements of human mAbs of the present invention are carried on a BIAcore™2000 instrument. Anti-human IgG is coated onto a BIAcore sensorchip CM-5 (BIAcore), so that application of defined amounts of human mAbs results in capturing on this prepared surface and hence in a change of refractory properties that are measured. A subsequent application of rhlL-4 results in a further change of the refractory properties, which allows determination of the association rate (Kon, on rate) as well as the dissociation rate (K^, off rate) and the product of these two, the affinity (K software. Using several concentrations of rhlL-4 in BIAbuffer, an affinity of 43 pM of an mAb as defined by CDRs as described in claim 2a) is determined. c) Determination of inhibitory potential on IL-4 mediated IgE c1) Cell sources Human B cells are isolated from peripheral blood, respectively, buffy coats by Ficoll-paque density centrifugation, followed by magnetic separation with MACS beads (Miltenyi Biotech) specific for human CD 19 or human CD22 on an AutoMACS device. NaTve human B cells are similarly isolated using anti-human slgD FITC labeled goat F(ab')2 antibodies followed by anti-FITC MACS beads. c2) Cell culture/maintenance Transfectants (BaF/3 transfectants carrying the IL-4Ra and the IL-13Ra1) are cultured in RPMI 1640 medium supplemented with Glutamax (Invitrogen), 10% FCS, 1% penicillin/streptomycin and 10 ng/ml rhlL-4 (Novartis). Cells are split 1:1 twice weekly, washed with fresh medium without rhlL-4 and kept in such medium overnight (=starved cells). Human ex vivo (naive) B cell cultures are incubated in X-Vivo medium (Cambrex, XV15) supplemented with Glutamax, 10% FCS, 1% penicillin/streptomycin in 96-well plates (Costar). c3) BAF cell proliferation assay Starved cells as described in b) are collected, washed with fresh medium, counted and adjusted to 2 x 105 cells/ml of which 100 ul per well are distributed to 96-well plates (Costar). Fortitration series the cytokines rhlL-4, rhlL-13 and rmlL-3 are prepared in 4 times the desired final concentration in the same medium. For titration series antibodies are either used as cell culture supernatants with ELISA determined concentrations or from purified material at 4 times the desired concentrations in the same medium. The pre-dilutions of cytokines and antibodies are mixed at equal volumes and 100 pi of the pre-mix are transferred to the well prepared with cells. Controls are set up for background proliferation (medium without cytokine and without antibody = 100% inhibition) and maximum proliferation (medium with cytokine only = 0% inhibition). After overnight incubation at 37° in the presence of 5% CO2, [methyl-3H]thimidine (Amersham TRK120) 1 pCi per well is added in 10 ul of medium and incubated for 8 hours. Following a freeze/thaw cycle cells are harvested from the plates on filter mats using a Tomtek harvester. Filter mats are dried in a microwave oven for 2 minutes at 650 W and transferred to a sample bag together with a sheet of Meltilex Scintillation Wax (Wallac). Wax is melted through the filter and filters obtained are placed inside appropriate cassettes and inserted into a micro-beta reader (Wallac) for scintillation counting using a program measuring 30 seconds per field and extrapolating to counts per minutes. An ICso of 30 pM is measured in this test system for the antibody. c4) IL-4 induced CD23 up-regulation on B cells MACS separated B cells are adjusted to 0.5-1 x 106 cells/ml in XV15 and plated out in 100ul per well of 96 well round bottom plates. Cytokines (1 ng/ml final) and mAb (2 ug/ml - 2 ng/ml final) are pre-diluted and pre-mixed as described above and added in 100 ul to reach a final volume of 200 pi. After culturing overnight at 37° in the presence of 5% CO2 cells are transferred to 96-well plates (Costar) and centrifuged at 2200 rpm (-1000 x g) for 1 minute after flicking off the supernatant washed with FACS buffer. Florochrome labeled mAbs [HLA-DR FITC (Caltag#MHLDR01 1:800), CD19 PE (Caltag#MHCD1904 1:200) and CD23 ARC (Caltag#MHCD2305 1:200)] are prepared in FACS buffer and distributed in 50ul per well. After 30-60 minutes incubation at RT, wells are filled up with FACS buffer, centrifuged and the centrifugation residue obtained is washed with FACS buffer. Cells are re-suspended in FACS buffer with 2ug/ml propidium iodide and analyzed on a dual laser FacsCalibur flow cytometer (BD Biosciences). Cells are gated according to their forward scatter and side scatter properties as well.as their ability to exclude propidium iodide and their CD19 expression. Mean fluorescence intensities and percentage of cells above arbitrary threshold (set on un-induced cells) in CD23 expression are determined. Baseline expression (100% inhibition) is determined on cells without cytokine, whereas 0% inhibition is set on cells incubated with cytokine but without mAb. An IC50 of 334 pM for this antibody is determined for IL-4 induced CD23 expression on the cells as described above in the presence of 70 pM recombinant human IL-4. c5) IL-4 induced IgE production by naYve B cells Magnetically sorted naYve B cells are adjusted to 3 x 105 cells per ml in XV15 and plated out in 100ul per well of 96-well plates in a 6 x 6 array in the center of the plate, surrounded by PBS filled wells during the 10 days of culture at 37° in the presence of 5% CO2. One plate each is prepared per mAb to be tested, consisting of 3 wells each un-induced and induced controls and quintuplicate repeats of mAb titrations starting at 7ug/ml and running in 3-fold dilution down to 29ng/ml final concentrations added in 50ul four times concentrated pre-dilution. Inducing conditions are rhlL-4 at 20 ng/ml plus anti-CD40 mAb (Novartis) at 0.5ug/ml final concentrations also added in 50ul of four times concentrated pre-dilution. IgE concentrations are determined at the end of the culture period by a standard sandwich ELISA method. An IC50 of 2806 pM for this antibody is determined for IL-4 induced IgE on the cells as described above. Examples 2 to 6: Antibodies are obtained analogously as described in example 1 and comprise the following amino acid sequences: Example 2 is an antibody comprising amino acid sequence SEQ ID NO:9 and SEQ ID NO: 16 Example 3 is an antibody comprising amino acid sequence SEQ ID NO: 17 and SEQ ID NO: 18. Example 4 is an antibody comprising amino acid sequence SEQ ID NO:25 and SEQ ID NO:26. Example 5 is an antibody comprising amino acid sequence SEQ ID NO:33 and SEQ ID NO:34. Example 6 is an antibody comprising amino acid sequence SEQ ID NO:41 and SEQ ID NO:42. (Table Removed) summarizes the IC50 values of the antibodies in the various test systems as described in (amino acid sequence of the mature polypeptide of the heavy chain, underlined amino acids correspond to CDR1, CDR2 and CDR3) QVQLVESGGGWQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVTFIWDDGSFKYYAES VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGSWSPDIFDIWGQGTMVTVSS SEQ ID NO:2 (amino acid sequence of the mature polypeptide of the light chain, underlined amino acids correspond to CDR1', CDR2' and CDR3') AIQLTQSPSSLSASVGDRVTITCRASQGISRALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSG SGTDFTLTISSLQPEDFATYYCQQFNSYPITFGQGTRLEIKRT SEQ ID N0:3 (amino acid sequence of the polypeptide of SEQ ID NO:1 with leader sequence, amino acids marked in bold correspond to the leader sequence) MEFGLNWVFLVALFRGVHCQVQLVESGGGWQPGRSLRLSCAASGFTFSSYAMHWVRQAPGK GLEWVTFIWDDGSFKYYAESVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGSWSPDIFDI WGQGTMVTVSS SEQ ID NO:4 17 (amino acid sequence of the polypeptide of SEQ ID NO:2 with leader sequence, amino acids marked in bold correspond to the leader sequence) MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQGISRALAWYQQKPGK APKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPITFGQGTRLEIKRT SEQ ID NO:5 (nucleotides encoding an amino acid sequence of SEQ ID NO:1) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCT CCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGCCATGCACTGGGTCCGCCAGGCTCCA GGCAAGGGGCTGGAGTGGGTGACATTTATATGGGATGATGGAAGTTTTAAATATTATGCAGAG TCCGTGAAGGGCCGATTCACCATCTCCAGAGACMTTCCAAGMCACGCTGTATTTGCAAATG AACAGCCTGAGAGCCGAAGACACGGCTGTGTATTACTGTGCGAGAGAGGGCAGCTGGTCTCC TGATATATTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA SEQ ID NO:6 (nucleotides encoding an amino acid sequence of SEQ ID NO:2) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATC ACTTGCCGGGCAAGTCAGGGCATTAGCAGAGCTTTAGCCTGGTATCAGCAGAAACCAGGGAA AGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAG CGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGC AACTTATTACTGTCAACAGTTTAATAGTTACCCCATCACCTTCGGCCAAGGGACACGACTGGA GATTAAACGAACT SEQ ID NO:7 (nucleotides encoding an amino acid sequence of SEQ ID NO:3) ATGGAGTTTGGGCTGAACTGGGTTTTCCTCGTTGCTCTTTTCAGAGGTGTCCACTGTCAGGTG CAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG CAGCGTCTGGATTCACCTTCAGTAGCTATGCCATGCACTGGGTCCGCCAGGCTCCAGGCAAG GGGCTGGAGTGGGTGACATTTATATGGGATGATGGAAGTTTTAAATATTATGCAGAGTCCGTG AAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATTTGCAMTGAACAGC CTGAGAGCCGAAGACACGGCTGTGTATTACTGTGCGAGAGAGGGCAGCTGGTCTCCTGATAT ATTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA SEQ ID NO:8 (nucleotides encoding an amino acid sequence of SEQ ID NO:4) ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCAG ATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCAC CATCACTTGCCGGGCAAGTCAGGGCATTAGCAGAGCTTTAGCCTGGTATCAGCAGAAACCAG GGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGT TCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGAT 18 TTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCCCATCACCTTCGGCCAAGGGACACGAC TGGAGATTAAACGAACT SEQ ID NO:9 (amino acid sequence of the mature polypeptide of the heavy chain, underlined amino acids correspond to CDR1, CDR2 and CDR3) QVQLVESGGGWQPGRSLRLSCAASGFTLSSFGMUWVRQAPGKGLEWVAVIWYDGSNEYYADS yKGRFTTSRDNSKNTLYLQMNSLRAEDTANA^YCAREGSWSPDIFDIWGQGTMVTVSS SEQ ID NO:10 (amino acid sequence of the mature polypeptide of the light chain, underlined amino acids correspond to CDR1', CDR2' and CDR3') AIQLTQSPSSLSASVGDRVTITCRTSQGIRSALAWYQQNPGKAPKLLIYDASSLESGVPSRFSGSG SGTDFTLTISSLQPEDFATYYCQQFNSYPVTFGQGTRLEIKRT SEQ ID NO: 11 (amino acid sequence of the polypeptide of SEQ ID NO:9 with leader sequence, amino acids marked in bold correspond to the leader sequence) MEFGLSWVFLVALLRGVQCQVQLVESGGGWQPGRSLRLSCAASGFTLSSFGMHWVRQAPGK GLEWVAVIWYDGSNEYYADSVKGRFTTSRDNSKNTLYLQMNSLRAEDTAWYCAREGSWSPDIF DIWGQGTMVTVSS SEQIDNO:12 (amino acid sequence of the polypeptide of SEQ ID NO: 10 with leader sequence, amino acids marked in bold correspond to the leader sequence) MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRTSQGIRSALAWYQQNPGK APKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPVTFGQGTRLEIKRT SEQIDNO:13 (nucleotides encoding an amino acid sequence of SEQ ID NO:9) CAGGTGCAACTGGTGGAGTCGGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTC TCCTGTGCAGCGTCTGGATTCACCTTAAGTAGCTTTGGCATGCACTGGGTCCGCCAGGCTCC AGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATGAATACTATGCAG ACTCCGTGAAGGGCCGATTCACCACCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAA ATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGAGGGCAGCTGGT CTCCTGATATTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA SEQ ID NO:14 (nucleotides encoding an amino acid sequence of SEQ ID NO: 10) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATC ACTTGCCGGACAAGTCAGGGCATTCGCAGTGCTTTAGCCTGGTATCAGCAGAACCCCGGGAA AGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAG CGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG 19 CAACTTATTACTGTCAACAGTTTAATAGTTACCCCGTCACCTTCGGCCAAGGGACACGACTGG AGATTAAACGAACT SEQIDNO:15 (nucleotides encoding an am/no acid sequence ofSEQ ID NO: 11) ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGTCCAGTGTCAGGTG CAACTGGTGGAGTCGGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG CAGCGTCTGGATTCACCTTAAGTAGCTTTGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAG GGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATGAATACTATGCAGACTCCGT GAAGGGCCGATTCACCACCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACA GCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGAGGGCAGCTGGTCTCCTGA TATTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA SEQIDNO:16 (nucleotides encoding an amino acid sequence ofSEQ ID NO: 12) ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCA GATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCA CCATCACTTGCCGGACAAGTCAGGGCATTCGCAGTGCTTTAGCCTGGTATCAGCAGAACCCC GGGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCGCATCAAG GTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAG ATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCCCGTCACCTTCGGCCAAGGGACACG ACTGGAGATTAAACGAACT SEQ ID NO:17 (amino acid sequence of the mature polypeptide of the heavy chain, underlined amino acids correspond to CDR1, CDR2 and CDR3) QVQLVESGGGMVQPGRSLRLSCAASGFTLSSYGMHWVRQAPGKGLEWVTVIWYDGNNQYYAD SyKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGSWSPDIFDIWGQGTMVTVSS SEQIDNO:18 (amino acid sequence of the mature polypeptide of the light chain, underlined amino acids correspond to CDR1', CDR2' and CDR3') AIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSG SGTDFTLTISSLQPEDFATYYCQQFNSYPITFGQGTRLEIKRT SEQ ID NO:19 (amino acid sequence of the polypeptide of SEQ ID NO: 17 with leader sequence, amino acids marked in bold correspond to the leader sequence) MEFGLSWVFLVALLRGVQCQVQLVESGGGMVQPGRSLRLSCAASGFTLSSYGMHWVRQAPGK GLEWVWIWYDGNNQYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGSWSPDIF DIWGQGTMVTVSS SEQ ID N0:20 20 (am/no acid sequence of the polypeptide ofSEQ ID NO: 18 with leader sequence, am/no acids marked in bold correspond to the leader sequence) MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGK APKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPITFGQGTRLEIKRT SEQ ID N0:21 (nucleotides encoding an am/no acid sequence of SEQ ID NO: 17) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCATGGTCCAGCCTGGGAGGTCCCTGAGACTCT CCTGTGCAGCGTCTGGATTCACCCTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCA GGCAAGGGGCTGGAGTGGGTGACAGTTATATGGTATGATGGAAATAATCAATACTATGCAGA CTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAAT GAACAGCCTGAGAGCCGAGGACACGGCTGTATATTACTGTGCGAGAGAGGGCAGCTGGTCT CCTGATATTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA SEQ ID NO:22 (nucleotides encoding an amino acid sequence of SEQ ID NO: 18) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATC ACTTGCCGGGCAAGTCAGGGCATTAGCAGTTATTTAGCCTGGTATCAGCAGAAACCAGGGAA AGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAG CGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGMGATTTTG CAACTTATTACTGTCAACAGTTTMTAGTTACCCCATCACC1TCGGCCAAGGGACACGACTGG AGATTAAACGAACT SEQ ID NO:23 (nucleotides encoding an amino acid sequence of SEQ ID NO: 19) ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGTCCAGTGTCAGGTG CAGCTGGTGGAGTCTGGGGGAGGCATGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG CAGCGTCTGGATTCACCCTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAG GGGCTGGAGTGGGTGACAGTTATATGGTATGATGGAAATAATCAATACTATGCAGACTCCGTG AAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGC CTGAGAGCCGAGGACACGGCTGTATATTACTGTGCGAGAGAGGGCAGCTGGTCTCCTGATAT TTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA SEQ ID NO:24 (nucleotides encoding an amino acid sequence of SEQ ID NO:20) ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCA GATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCA CCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGTTATTTAGCCTGGTATCAGCAGAAACCA GGGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAG GTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAG ATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCCCATCACCTTCGGCCAAGGGACACG ACTGGAGATTAAACGAACT SEQ ID N0:25 (amino acid sequence of the mature polypeptide of the heavy chain, underlined amino acids correspond to CDR1, CDR2 and CDR3) QVQLVQSGAEVKKPGSSVKVSCKASGDTFSSYAISWVRQAPGQGFEWMGGIIPVIGTVNYEERF QDRVTITADNSTSTAYMELTSLRSEDTAVYFCGREEGFLDYWGQGTLVTVSS SEQ ID NO:26 (amino acid sequence of the mature polypeptide of the light chain, underlined amino acids correspond to CDR1', CDR2' and CDR3') AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSG SGTDFTLTISSLQPEDFATYYCQQFNSYPLLTFGGGTKVEIKRT SEQ ID N0:27 (amino acid sequence of the polypeptide of SEQ ID NO:25 with leader sequence, amino acids marked in bold correspond to the leader sequence) MD.WTWRFLFWAAATGVQSQVQLVQSGAEVKKPGSSVKVSCKASGDTFSSYAISWVRQAPGQ GFEWMGGIIPVIGTVNYEERFQDRVTITADNSTSTAYMELTSLRSEDTANA'FCGREEGFLDYWGQ GTLVTVSS SEQ ID NO:28 (amino acid sequence of the polypeptide of SEQ ID NO:26 with leader sequence, amino acids marked in bold correspond to the leader sequence) MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKP GKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPLLTFGGGTK VEIKRT SEQ ID N0:29 (nucleotides encoding an amino acid sequence of SEQ ID NO:25) CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCT CCTGCMGGCTTCTGGAGACACCTTCAGCAGTTATGCTATCAGTTGGGTGCGACAGGCCCCT GGACAAGGGTTTGAGTGGATGGGAGGGATCATCCCTGTCATTGGTACAGTAAATTATGAAGA GAGATTCCAGGACAGAGTCACGATTACCGCGGACAATTCCACGAGCACAGCCTACATGGAGT TGACTAGTCTGAGATCTGAAGACACGGCCGTGTAI I I I IGTGGGAGAGAAGAGGGCTTCCTT GACTATTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA SEQ ID NO:30 (nucleotides encoding an amino acid sequence of SEQ ID NO:26) ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCA GATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCA CCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCA 22 GGGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAG GTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAG ATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCCTCTTCTCACTTTCGGCGGAGGGAC CAAGGTGGAGATCAAACGTACG SEQ ID NO:31 (nucleotides encoding an am/no acid sequence of SEQ ID NO:27) ATGGACTGGACCTGGAGGTTCCTCTTTGTGGTGGCAGCAGCTACAGGTGTCCAGTCCCAGGT CCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGC AAGGCTTCTGGAGACACCTTCAGCAGTTATGCTATCAGTTGGGTGCGACAGGCCCCTGGACA AGGGTTTGAGTGGATGGGAGGGATCATCCCTGTCATTGGTACAGTAAATTATGAAGAGAGATT CCAGGACAGAGTCACGATTACCGCGGACAATTCCACGAGCACAGCCTACATGGAGTTGACTA GTCTGAGATCTGAAGACACGGCCGTGTATTTTTGTGGGAGAGAAGAGGGCTTCCTTGACTATT GGGGCCAGGGAACCCTGGTCACCGTCTCCTCA SEQ ID NO:32 (nucleotides encoding an am/no acid sequence of SEQ ID NO:28) ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCA GATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCA CCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCA GGGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCMG GTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAG ATTTTGCMCTTATTACTGTCMCAGTTTAATAGTTACCCTCTTCTCACTTTCGGCGGAGGGAC CAAGGTGGAGATCAAACGTACG SEQ ID NO:33 (amino acid sequence of the mature polypeptide of the heavy chain, underlined am/no acids correspond to CDR1, CDR2 and CDR3) QVQLVESGGGWQPGRSLRLSCAASGFTFSCCGMHWVRQAPGKGLEWVAVIWYDGSNKYYAD S^KGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCATDSSGSFYEYFQHWGQGTLVTVSS SEQ ID NO:34 (amino acid sequence of the mature polypeptide of the light chain, underlined amino acids correspond to CDR1', CDR2' and CDR3') AIQLTQSPSSLSASVGDRVTITCRASQGINSAU\WYQQKPGKAPKLLIYDASSLESGVPSRFSGSG SGTDFTLTISSLQPEDFATYYCQQFNSYPYTFGQGTKLEIKRT SEQ ID NO:35 (amino acid sequence of the polypeptide of SEQ ID NO:33 with leader sequence, amino acids marked in bold correspond to the leader sequence) 23 MEFGLSWVFLVALLRGVQCQVQLVESGGGWQPGRSLRLSCAASGFTFSCCGMHWVRQAPGK GLEWVAVIWYDGSNKYYADSVKGRFTISRDTSKNTLYLQMNSLRAEDTAVYYCATDSSGSFYEYF QHWGQGTLVTVSS SEQ ID NO:36 (amino acid sequence of the polypeptide of SEQ ID NO:34 with leader sequence, amino acids marked in bold correspond to the leader sequence) MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQGINSALAWYQQKPGK APKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPYTFGQGTKLEIKRT SEQ ID NO:37 (nucleotides encoding an amino acid sequence of SEQ ID NO:33) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCT CCTGTGCAGCGTCTGGATTCACCTTCAGTTGCTGTGGCATGCACTGGGTCCGCCAGGCTCCA GGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGA CTCCGTGAAGGGCCGATTCACCATCTCCAGAGACACTTCCAAGAACACGCTGTATCTGCAAAT GAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGACAGATAGTTCGGGGAGTT TTTATGAATACTTCCAGCACTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCA SEQ ID NO:38 (nucleotides encoding an amino acid sequence of SEQ ID NO:34) GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATC ACTTGCCGGGCAAGTCAGGGCATTAACAGTGCTTTAGCCTGGTATCAGCAGAAACCAGGGAA AGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAG CGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG CAACTTATTACTGTCAACAGTTTAATAGTTACCCGTACACTTTTGGCCAGGGGACCAAGCTGG AGATCAAACGAACT SEQ ID NO:39 (nucleotides encoding an amino acid sequence of SEQ ID NO:35) ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGTCCAGTGTCAGGTG CAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG CAGCGTCTGGATTCACCTTCAGTTGCTGTGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAG GGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAATAAATACTATGCAGACTCCGT GAAGGGCCGATTCACCATCTCCAGAGACACTTCCAAGAACACGCTGTATCTGCAAATGAACA GCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGACAGATAGTTCGGGGAGI II I I AT GAATACTTCCAGCACTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCA SEQ ID NO:40 (nucleotides encoding an amino acid sequence of SEQ ID NO:36) ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCA GATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCA 24 CCATCACTTGCCGGGCAAGTCAGGGCATTAACAGTGCTTTAGCCTGGTATCAGCAGAAACCA GGGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAG GTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAG ATTTTGCMCTTATTACTGTCAACAGTTTAATAGTTACCCGTACACTTTTGGCCAGGGGACCAA GCTGGAGATCAAACGAACT SEQ ID NO:41 Cam/no acid sequence of the mature polypeptide of the heavy chain, underlined am/no acids correspond to CDR1, CDR2 and CDR3) QVQLVESGGGWQPGRSLRLSCAASGFTFSGYGMHWVRQAPGRGLDWVAWWYDGGYKFYA DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDSSGSFYEYLQHWGQGTLVTVSS SEQ ID NO:42 (amino acid sequence of the mature polypeptide of the light chain, underlined amino acids correspond to CDR1', CDR2' and CDR3') AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSG SGTDFTLTISSLQPEDFATYYCQQFNSY£HFWPGDQAGDQTNCG SEQ ID NO:43 (amino acid sequence of the polypeptide of SEQ ID NO:41 with leader sequence, amino acids marked in bold correspond to the leader sequence) MEFGLSWVFLVALLRGVQCQVQLVESGGGWQPGRSLRLSCAASGFTFSGYGMHWVRQAPGR GLDWVANAWYDGGYKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDSSGSFYEY LQHWGQGTLVTVSS SEQ ID NO:44 (amino acid sequence of the polypeptide of SEQ ID NO:42 with leader sequence, amino acids marked in bold correspond to the leader sequence) MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGK APKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYPHFWPGDQAGDQT NCG SEQ ID NO:45 (nucleotides encoding an amino acid sequence of SEQ ID NO:41) CAGGTGCAGTTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCT CCTGTGCAGCGTCTGGATTCACCTTCAGTGGCTATGGCATGCACTGGGTCCGCCAGGCTCCA GGCAGGGGGCTGGACTGGGTGGCAGTTGTGTGGTATGATGGAGGTTATAAGTTCTATGCAGA CTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAAT GAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATAGTTCGGGGAGTT TTTATGAATACTTACAACATTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCA SEQ ID NO:46 (nucleotides encoding an amino acid sequence of SEQ ID NO:42) 25 GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATC ACTTGCCGGGCAAGTCAGGGCATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCAGGGAA AGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTrGGAAAGTGGGGTCCCATCAAGGTTCAG CGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG CAACTTATTACTGTCAACAGTTTAATAGTTACCCTCACTTTTGGCCAGGGGACCAAGCTGGAG ATCAAACGAACT SEQ ID NO:47 (nucleotides encoding an am/no acid sequence of SEQ IDNO:43) ATGGAGT7TGGGCTGAGCTGGGTTTTCCTCGTTGCTCTTTTAAGAGGTGTCCAGTGTCAGGTG CAGTTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG CAGCGTCTGGATTCACCTTCAGTGGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAG GGGGCTGGACTGGGTGGCAGTTGTGTGGTATGATGGAGGTTATAAGTTCTATGCAGACTCCG TGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACA GCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATAGTTCGGGGAGI I I I I AT GAATACTTACAACATTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCA SEQ ID N0:48 (nucleotides encoding an amino acid sequence of SEQ ID NO:44) ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCA GATGTGCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCA CCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCA GGGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAG GTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAG ATTTTGCAACTTATTACTGTCMCAGTTTAATAGTTACCCTCACTTTTGGCCAGGGGACCAAGC TGGAGATCAAACGAACT Patent Claims 1. An human IL-4 specific antibody which binds to human IL-4 with a dissociation constant Kj of equal or less than 800 pM. 2. An antibody of claim 1 having a first domain comprising in sequence the hypervariaWe regions CDR1, CDR2 and CDR3 and a second domain comprising in sequence the hypervariable regions CDR1', CDR21 and CDR31 selected from the group consisting of an antibody wherein a) said CDR1 has the amino acid sequence Gly-Phe-Thr-Phe-Ser-Ser-Tyr-Ala-Met-His, said CDR2 has the amino acid sequence Phe-lle-Trp-Asp-Asp-Gly-Ser-Phe-Lys-Tyr-Tyr- Ala-Glu-Ser-Val-Lys-Gly, said CDR3 has the amino acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-lle-Phe, said CDRV has the amino acid sequence Ser-Gln-Gly-lle-Ser-Arg-Ala, said CDR2' has the amino acid sequence Asp-Ala-Ser, said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-lle, b) said CDR1 has the amino acid sequence Gly-Phe-Thr-Leu-Ser-Ser-Phe-Gly-Met-His, said CDR2 has the amino acid sequence Val-lle-Trp-Tyr-Asp-Gly-Ser-Asn-Glu-Tyr-Tyr-Ala- Asp-Ser-Val-Lys-Gly, said CDR3 has the amino acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-lle-Phe, said CDRV has the amino acid sequence Ser-Gln-Gly-lle-Arg-Ser-Ala, said CDR2' has the amino acid sequence Asp-Ala-Ser, said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-Val, c) said CDR1 has the amino acid sequence Gly-Phe-Thr-Leu-Ser-Ser-Tyr-Gly-Met-His, said CDR2 has the amino acid sequence Val-lle-Trp-Tyr-Asp-Gly-Asn-Asn-Gln-Tyr-Tyr-Ala- Asp-Ser-Val-Lys-Gly, said CDR3 has the amino acid sequence Glu-Gly-Ser-Trp-Ser-Pro-Asp-lle-Phe, said CDR11 has the amino acid sequence Ser-Gln-Gly-lle-Ser-Ser-Tyr, said CDR2' has the amino acid sequence Asp-Ala-Ser, said CDR31 has the amino acid sequence Phe-Asn-Ser-Tyr-Pro, d) said CDR1 has the amino acid sequence Gly-Asp-Thr-Phe-Ser-Ser-Tyr-Ala-lle-Ser, said CDR2 has the amino acid sequence Gly-lle-lle-lle-Pro-Val-lle-Gly-Thr-Val-Asn-Tyr- Glu-Glu-Arg-Phe-Gln-Asp-Arg, said CDR3 has the amino acid sequence Glu-Glu-Gly-Phe-Leu, said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Ser-Ser-Ala, said CDR2' has the amino acid sequence Asp-Ala-Ser, said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-Leu, e) said CDR1 has the amino acid sequence Gly-Phe-Thr-Phe-Ser-Cys-Cys-Gly-Met-His, 27 said CDR2 has the amino acid sequence Val-lle-Trp-Tyr-Asp-Gly-Ser-Asn-Lys-Tyr-Tyr-Ala- Asp-Ser-Val-Lys-Gly, said CDR3 has the amino acid sequence Asp-Ser-Ser-Gly-Ser-Phe-Tyr-Glu-Tyr-Phe, said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Asn-Ser-Ala, said CDR2' has the amino acid sequence Asp-Ala-Ser, said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-Tyr, and f) said CDR1 has the amino acid sequence Gly-Phe-Thr-Phe-Ser-Gly-Tyr-Gly-Met-His, said CDR2 has the amino acid sequence Val-Val-Trp-Tyr-Asp-Gly-Gly-Tyr-Lys-Phe-Tyr- Ala-Asp-Ser-Val-Lys-Gly, said CDR3 has the amino acid sequence Asp-Ser-Ser-Gly-Ser-Phe-Tyr-Glu-Tyr-Leu, said CDR1' has the amino acid sequence Ser-Gln-Gly-lle-Ser-Ser-Ala, said CDR2' has the amino acid sequence Asp-Ala-Ser, said CDR3' has the amino acid sequence Phe-Asn-Ser-Tyr-Pro-His. 3. An antibody of claim 1 or 2 comprising a) a polypeptide of SEQ ID NO:1 and a polypeptide of SEQ ID NO:2, or b) a polypeptide of SEQ ID NO:9 and a polypeptide of SEQ ID NO: 10, or c) a polypeptide of SEQ ID NO:17 and a polypeptide of SEQ ID NO:18, or d) a polypeptide of SEQ ID NO:25 and a polypeptide of SEQ ID NO:26, or e) a polypeptide of SEQ ID NO:33 and a polypeptide of SEQ ID NO:34, or f) a polypeptide of SEQ ID NO:41 and a polypeptide of SEQ ID NO:42. 4. An antibody of any one of claims 1 to 3 comprising a) a polypeptide of SEQ ID NO:3 and a polypeptide of SEQ ID NO:4, or b) a polypeptide of SEQ ID NO:11 and a polypeptide of SEQ ID NO:12, or c) a polypeptide of SEQ ID NO:19 and a polypeptide of SEQ ID NO:20, or d) a polypeptide of SEQ ID NO:27 and a polypeptide of SEQ ID NO:28, or e) a polypeptide of SEQ ID NO:35 and a polypeptide of SEQ ID NO:36, or f) a polypeptide of SEQ ID NO:43 and a polypeptide of SEQ ID NO:44. 5. An antibody of any one of claims 1 to 4 which is selected from the group consisting of an human IL-4 specific monoclonal antibody, a fragment thereof and an analog thereof. 6. Isolated polynucleotides comprising polynucleotides encoding an antibody of claim 1. 7. Polynucleotides of claim 6 encoding the amino acid sequence of an antibody of any one of claims 2 to 5. 8. Polynucleotides of any one of claims 6 or 7 comprising a) a polynucleotide of SEQ ID NO:5 and a polynucleotide of SEQ ID NO:6, or b) a polynucleotide of SEQ ID NO:13 and a polynucleotide of SEQ ID NO:14, or c) a polynucleotide of SEQ ID NO:21 and a polynucleotide of SEQ ID NO:22, or d) a polynucleotide of SEQ ID NO:29 and a polynucleotide of SEQ ID NO:30, or e) a polynucleotide of SEQ ID NO:37 and a polynucleotide of SEQ ID NO:38, or f) a polynucleotide of SEQ ID NO:45 and a polynucleotide of SEQ ID NO:46. 9. Polynucleotides of any one of claims 6 to 8 encoding a) a polypeptide of SEQ ID NO:7 and SEQ ID NO:8, or b) a polypeptide of SEQ ID NO:15 and SEQ ID NO:16, or c) a polypeptide of SEQ ID NO:23 and SEQ ID NO:24, or d) a polypeptide of SEQ ID NO:31 and SEQ ID NO:32, or e) a polypeptide of SEQ ID NO:39 and SEQ ID NO:40, or f) a polypeptide of SEQ ID NO:47 and SEQ ID NO:48. 10. An expression vector comprising polynucleotides of any one of claims 6 to 9. 11. An expression system comprising a polynucleotide of any one of claims 6 to 9 wherein said expression system or part thereof is capable of producing an antibody of any one of claims 1 to 5 when said expression system or part thereof is present in a compatible host cell. 12. An isolated host cell comprising an expression system of claim 11. 13. Use of an antibody of any one of claims 1 to 5 as a pharmaceutical. 14. Use of an antibody of any one of claims 1 to 5 for the manufacture of a medicament for the treatment of diseases mediated by IL-4 and/or IgE. 15. Use of claim 14 wherein the disease is selected from the group consisting of atopic dermatitis, allergic asthma and allergic rhinitis. 16. Use of any one of claims 13 to 15 wherein the antibody is selected from the group consisting of an human IL-4 monoclonal antibody, a fragment thereof and an analog thereof. 17. A pharmaceutical composition comprising an antibody of any one of claims 1 to 5 in 29 association with at least one pharmaceutically acceptable excipient. 18. A method of treatment of diseases mediated by IL-4 and/or IgE which treatment comprises administering to a subject in need of such treatment an effective amount of an antibody of any one of claims1to5.

Documents:

1121-delnp-2007-Abstract-(26-02-2013).pdf

1121-delnp-2007-abstract.pdf

1121-delnp-2007-Assignment-(28-01-2013).pdf

1121-delnp-2007-Claims-(26-02-2013).pdf

1121-delnp-2007-claims.pdf

1121-delnp-2007-Correspondence Others-(26-02-2013).pdf

1121-delnp-2007-Correspondence Others-(28-01-2013).pdf

1121-delnp-2007-Correspondence-Others-(05-02-2013).pdf

1121-delnp-2007-Correspondence-Others-(27-02-2013).pdf

1121-delnp-2007-correspondence-others.pdf

1121-delnp-2007-description (complete).pdf

1121-delnp-2007-form-1.pdf

1121-delnp-2007-form-2.pdf

1121-delnp-2007-Form-3-(05-02-2013).pdf

1121-delnp-2007-Form-3-(26-02-2013).pdf

1121-delnp-2007-form-3.pdf

1121-delnp-2007-form-5.pdf

1121-delnp-2007-GPA-(28-01-2013).pdf

1121-delnp-2007-pct-210.pdf

1121-delnp-2007-pct-237.pdf

1121-delnp-2007-pct-373.pdf

1121-delnp-2007-pct-notification.pdf

1121-delnp-2007-Petition-137-(27-02-2013).pdf

1121-delnp-2007-Petition-138-(27-02-2013).pdf