Title of Invention	"EFFECTOR CONJUGATE OF EPOTHILONE AND EPOTHILONE DERIVATIVES"
Abstract	Effector conjugate of epothilone and epothilone derivatives of general formula (I):

Full Text

The present invention relates to effector conjugate of general formula (I). The development of the understanding relating to the recognition of binding regions, especially in the field of monoclonal antibodies or fragments thereof against specific tumor antigens, makes it possible to consider a selective tumor therapy by specific release of an anti-tumor active agent at the target site. A precondition for such an approach, in which a highly active (toxic) active agent (effector) is coupled to a high-molecular, tumor-specific recognition unit, such as, for example, to an antibody, is a substantial inactivity of the conjugate, whose minimum components are represented by a recognition unit and an effector, until it has reached the target site (tumor). Arriving at the target site, the conjugate binds to the cell surface and the active ingredient, optionally after the preceding internalization of the entire complex, can be released. The successful therapy of solid tumors, especially with monoclonal antibodies, can be limited, however, by an inadequate penetration of the antibody into the tumor as well as the heterogeneous dispersion of the corresponding tumor-associated antigens in the tumor tissue. These limitations could be avoided in that the tumor-vascular system is attacked in a specific way. The growth of tumors below a volume of about 2 mm3 depends on a neoangiogenesis. The subsequent tumor growth is based on an intact vascular system, which ensures die supply with nutrients or the removal of waste products. The selective destruction of this system should therefore result in a necrosis of the tumor. The attack on the vascular system of the tumor promises a number of advantages relative to the direct attack on the tumor itself. In comparison to tumor cells, endothelial cells are easier to access, since no rumor tissue has to be penetrated. The damage of an individual tumor vessel should result in a necrosis of thousands of tumor cells. To damage a rumor wssel, it is not necessary to kill all endothelial cells. The specific attack of endothelial cells in or close to the tumors minimizes systemic side effects. Endothelial cells are genetically very stable, so that the probability of a development of resistance against the tumor therapeutic agent is low. (Formula Removed) Within the scope of this invention, surprisingly enough, a possibility has now been found to link the chemically very sensitive, highly-functionalized class of active agents of epothilones and analogs thereof to a high-molecular recognition unit via different linkers in different positions of the active agent. The object of this invention is thus, inter alia, 1. to find a method to link highly active active agents from the structural class of the epothilones and epothilone derivatives to suitable linkers, 2. to synthesize suitable linkers, 3. to develop a method to link these epothilone-linker conjugates to recognition units, such as, for example, monoclonal antibodies or fragments thereof, to form immune conjugates that are both chemically and metabolically sufficiently stable for the development of a pharmaceutical, and that are superior to the epothilones or epothilone derivatives that are taken as a basis with respect to their therapeutic range, their selectivity of action and/or undesirable toxic side effects and/or the degree of their activity. This invention accordingly comprises effector conjugates of general formula I (Formula Removed) in which Rla, Rlb, independently of one another, are hydrogen, C1-C10 alkyl, aryl, aralkyl, or together a -(CH2)m group, in which m is 2 to 5, R2a, R2b, independently of one another, are hydrogen, C1-C10 alkyl, aryl, aralkyl, or together a -(CH2)n group, in which n is 2 to 5, or C2-C10 (Formula Removed) alkenyl, or C2-C10 alkynyl, R3 is hydrogen, C1-C10 alkyl, aryl or aralkyl, and R4a, R4b; independently of one another, are hydrogen, C1-C10 alkyl, aryl, aralkyl, or together a -{CH2)p group, in which p is 2 to 5, R5 is hydrogen, C1-C10 alkyl, aryl, aralkyl, CO2H, CO2alkyl, CH2OH, CH2OAlkyl, CH2OAcyl, CN, CH2NH2, CH2N(alkyl, acyl)l,2, or CH2Hal, Hal is a halogen atom, R6, R7 in each case are hydrogen, or together an additional bond, or together an oxygen atom, or together an NH group, or together an N-alkyl group, or together a CH2 group, and G is an oxygen atom or CH2, D-E is a group H2C-CH2, HC=CH, C=C, CH(OH)-CH(OH), CH(OH)-CH2, CH2-CH(OH), O-CH2, or, if G represents a CH2 group, D-E is CH2-0, W is a group C(=X)R8, or a bi- or tricyclic aromatic or heteroaromatic radical, L3 is hydrogen, or, if a radical in W contains a hydroxyl group, forms a group O-L4 with the latter, or, if a radical in W contains an amino group, forms a group NR25-L4 with the latter. R25 is hydrogen or C1-C10 alkyl, (Formula Removed) is an oxygen atom, or two OR20 groups, or a C2-C10 alkylenedioxy group that may be straight-chain or branched, or H/OR9, or a CR^Rl 1 group, R8 is hydrogen, C1-C10 alkyl, aryl, aralkyl, halogen or CN, and R9 is hydrogen or a protective group PGX, RlO, R11 in each cash independently of one another, are hydrogen, C2-C20 alkyl, aryl, aralkyl, or together with a methylene carbon atom form a 5- to 7-membered carbocyclic ring, Z can represent oxygen or H/OR12, R12 can represent hydrogen or a protective group PGA A-Y can represent a group O-C(=O), O-CH2, CH2-C(=O), NR21 -C(=O) or NR21-SO2, R20 can represent C1-C20 alkyl, R21 can represent a hydrogen atom or C1-C10 alkyl, PG-X, PGY5 and PGZ can represent a protective group PG, and L1, L2, and L4, independently of one another, can represent hydrogen, a group C(=O)C1, a group C(=S)C1, a group PG Y or a linker of general formula ail) or (IV); provided that at least one substituent L1, L2 or L4 represents a linker of general formula (III) or (IV); the linker of general formula (III) has the following structure, (Formula Removed) in which T can represent oxygen or sulfur, U can represent oxygen, CHR22. CHR22-NR23-C(=O), CHR22-NR23- C(=S), 0-C(=0)-CHR22-NR23-C(=0)-, O-C(O)-CHR22-NR23- C(=S) or NR24a, o can represent 0 to 15, V can represent a bond, aryl, a group NR24b-C(=0)-0-(CH2)s (Formula Removed) or a group NR24b-C(=S)-0-(CH2)s (Formula Removed) s can represent 0 to 4, Q can represent a bond, O-C(=O)-NR24c, O-C(=S)-NR24c, (Formula Removed) , or R22 can represent hydrogen, C1-C10 alkyl, aryl or aralkyl, R23 can represent hydrogen or C1-C10 alkyl, R24a, R24b, and R24c; independently of one another, can represent hydrogen C1-C10 alkyl, q can represent 0 to 15, (Formula Removed) FG1 can represent C1-C10alkyl-S3, (Formula Removed) 0 , or CO2H; and the linker of general formula (IV) has the following structure, (Formula Removed) in which T can represent oxygen or sulfur, W1, W2 are the same or different and can represent oxygen or NR o can represent 0 to 5, R22 can represent hydrogen, C1-C10 alkyl, aryl or aralkyl, OT R can represent hydrogen, or C1-C10 alkyl, R24a can represent hydrogen or C1-C10 alkyl, R27 can represent halogen, CN, NO2, CO2R28, or OR28r R28 can represent hydrogen, C1-C10 alkyl, aryl or aralkyl, q can represent 0 to 5, U can represent oxygen, CHR22, CHR22-NR23-C(=O)-, CHR22-NR23-C(=S)- or C1-C10 alkyl, r can represent 0 to 20, FG1 can represent C1-C10 alkyl-S3, (Formula Removed) as a single isomer or a mixture of different isomers and/or as a pharmaceutically acceptable salt thereof. In addition, the invention describes the production of effector recognition unit conjugates of general formula (I), wherein the substituents therein have the above-mentioned meanings, but at least one group FG1 is replaced by a group FG2a or FG2b, wherein FG2a or FG2b can have the following meanings: (Formula Removed) and wherein a recognition unit is conjugated via a sulfur atom with the group FG2a, wherein the indicated sulfur atom is a component of the recognition unit, or via an amide fbnction of group FG2b, wherein the indicated nitrogen atom is a component of the recognition unit; wherein the recognition unit can be, for example, a peptide, a soluble receptor, a cytokine. a lymphokine, an aptamer, a spiegelmer, a recombinant protein, a framework structure, a monoclonal antibody or a fragment of a monoclonal antibody. According to this invention, the above-mentioned effector recognition unit conjugates can comprise one or more recognition units; in this case, the recognition units that belong to a conjugate can be identical or different. It is preferred that the recognition units of a conjugate be identical. The effector recognition unit conjugates according to the invention can be used in the form of their α-, ß- or γ-cyclodextrin-clathrates or in the form of liposomal or pegylated compositions. The conjugates according to the invention are preferably used for the treatment of diseases that are associated with proliferative processes. For example, the therapy of different tumors, the therapy of inflammatory and/or neurodegenerative diseases, such as multiple sclerosis or Alzheimer's disease, the therapy of angiogenesis- (Formula Removed) associated diseases such as the growth of solid tumors, rheumatoid arthritis or diseases of the ocular fundus, can be mentioned. The production of epothilones, their precursors and derivatives of general formula I is carried out according to the methods that are known to one skilled in the art, as they are described in, for example, DE 19907588, WO 98/25929, WO 99/58534, WO 99/2514, WO 99/67252, WO 99/67253, WO 99/7692, EP 99/4915, WO 00/485, WO 00/1333, WO 00/66589, WO 00/49019, WO 00/49020, WO 00/49021, WO 00/71521, WO 00/37473, WO 00/57874, WO 01/92255, WO 01/81342, WO 01/73103, WO 01/64650, WO 01/70716, US 6204388, US 6387927, US 6380394, US 02/52028, US 02/58286, US 02/62030, WO 02/32844, WO 02/30356, WO 02/32844, WO 02/14323, and WO 02/8440. As alkyl groups Rla, Rib, R2a R2b R3 R4a R4b R5; R8; R10? Rl ls R20; R21, R22, R23, R24a, R24b R24cs R25 R26; straight-chain or branched-chain alkyl groups with 1-20 carbon atoms can be considered, such as, for example, methyl, ethyl, propyl, isopropyl, butyl, isoburyl, tert.-butyl, penryl, isopentyl, neopentyl, heptyl, hexyl, and decyl. Alkyl groups Rla, Rlb, R2a, R2b, R3, R4a, R4b, R5, R8, R10, R11, R20, R21, R22, R23, R24a, R24b, R24c, R25 and R26 can also be perfluorinated or substituted by 1-5 halogen atoms, hydroxy groups, C1-C4alkoxy groups or C6-Ci2-aryl groups (which can be substituted by 1-3 halogen atoms). As aryl radicals R*a Rlb R2a, R2b R3, R4a, R4b, R5, R8, R10, R11, R22, R2(> and V, substituted and unsubstituted carbocyclic or heterocyclic radicals with one or more heteroatoms, such as phenyl, naphthyl, furyl, thienyl, pyridyl, pyrazolyl, pyrimidinyl, oxazolyl, pyridazinyl, pyrazinyl, quinolyl, thiazolyl, benzothiazolyl or benzoxazolyl, which can be substituted in one or more places by halogen, OH, O-alkyl, CO2H, C02-alkyl, -NH2, -NO2, -N3, -CN, C1-C20-alkyl, C1-C20-acyl or C1-C20-acyloxy groups, are suitable. The heteroatoms can be oxidized provided that this does not cause the aromatic character to be lost, such as, for example, the oxidation of a pyridyl to a pyridyl-N-oxide. As bicyclic and tricyclic aryl radicals W, substituted and unsubstituted, carbocyclic or heterocyclic radicals with one or more heteroatoms such as naphthyl, anthryl, benzothiazolyl, benzoxazolyl, benzimidazolyi, quinolyl, isoquinolyl, benzoxazinyl, benzofuranyl, indolyl, indazolyl, quinoxalinyl, tetrahydroisoquinolinyl. tetrahydroquinolinyl, thienopyridinyl, pyridopyridinyl, benzopyrazolyl, benzotriazolyl, or dihydroindolyl, which can be substituted in one or more places by halogen, OH, O-alkyl, CO2H, CO2-alkyl, -NH2, -NO2, -N3, -CN. C1-C20-alkyl, C1-C20-acyl or C1-C20-acyloxy groups, are suitable. The heteroatoms can be oxidized provided that this does not cause the aromatic character to be lost, such as, for example, the oxidation of a quinolyl to a quinolyl-N-oxide. The aralkyl groups in Rla, Rlb, R2a, R2b, R3, R4a, R4b, R5, R8, R10, R11 R22 and R26 can contain in the ring up to 14 C atoms, preferably 6 to 10C atoms, and in the alkyl chain 1 to 8 atoms, preferably 1 to 4 atoms. As an aralkyl radical, for example, benzyl, phenylethyl, naphthylmethyl, naphthylethyl, furylmethyl, thienylethyl or pyridylpropyl is suitable. The rings can be substituted in one or more places by halogen, OH, O-alkyl, CO2H, CO2-alkyl, -NO2, -N3, -CN, C1-C20-alkyl, C1-C20-acyl or C1-C20-acyloxy groups. As representatives of protective groups PG, tris(C1-C20 alkyl)silyl, bis(C1-C20 alkyl)-arylsilyl, (C1-C20 alkyl)-diarylsilyl, tris(aralkyl)-silyl, C1-C20-alkyl, C2-C20-alkenyl, C4-C7-cycloalkyl, which in addition an contain an oxygen atom in the ring, aryl, C7-C20-aralkyl, C1-C20-acyl, aroyl, C1-C20-alkoxycarbonyl, C1-C20-alkylsulfonyl as well as arylsulfonyl can be cited. As alkyl-, silyl- and acyl radicals for the protective groups PG, especially the radicals that are known to one skilled in the art are considered. Preferred are the alkyl or silyl radicals that can be easily cleaved from the corresponding alkyl and silyl ethers, such as, for example, the methoxymethyl, methoxyethyl, ethoxyethyl, tetrahydropyranyl, tetrahydrofuranyl, trimethylsilyl, triethylsilyl, tert.-butyldimethylsilyl, tert.-butyldiphenylsilyl, tribenzylsilyl, triisopropylsilyl, benzyl, para-nitrobenzyl, and para-methoxybenzyl radicals, as well as alkylsulfonyl and arylsulfonyl radicals. As an alkoxycarbonyl radical, e.g., trichloroethyloxycarbonyl (Troc) is suitable. As an acyl radical, e.g., formyl, acetyl, propionyl. isopropionyl, trichloromethylcarbonyl, pivalyl, butyryl or benzoyl, which radical can be substituted with an amino and/or hydroxy group, is suitable. As amino protective groups PG, the radicals that are known to one skilled in the art are suitable. For example, the Alloc, Boc, Z, benzyl, f-Moc, Troc, stabase or benzostabase group can be mentioned. As halogen atoms, fluorine, chlorine, bromine or iodine can be considered. (Formula Removed) The acyl groups can contain 1 to 20 carbon atoms, formyl, aceryl, propionyl, isopropionyl and pivalyl groups being preferred. The C2-C10-alkylene-α,ω-dioxy group that is possible for X is preferably an ethylene ketal or neopentyl ketal group. Preferred compounds of general formula 1 are those in which A-Y represents O-C(=O) or NR21-C(=O); D-E represents an H2C-CH2 group; G represents a CH2 group; Z represents an oxygen atom; R.la, R1b in each case represent C1-C10 alkyl or together a -(CH2)p group with p equal to 2 or 3 or 4; R2a, R2b, independently of one another, represent hydrogen, C1-C10 alkyl, C2-C10 alkenyl. or C2-C10 alkynyl; R3 represents hydrogen; R4a, R4b, independently of one another, represent hydrogen or C1-C10 alkyl; R5 represents hydrogen, or C1-C4 alkyl or CH2OH or CH2NH2 or CH2N(alkyl, acyl)1;2 or CH2Hal; R6 and R7 together represent an additional bond or together an NH group or together an N-alkyl group or together a CH2 group or together an oxygen atom; W represents a group C(=X)R8 or a 2-methylbenzothiazol-5-yl radical or a 2-methylbenzoxazol-5-yl radical or a quinolin-7-yl radical or a 2-aminomethylbenzothiazol-5-yl radical or a 2-hydroxymethylbenzothiazol-5-yl radical or a 2-aminomethylbenzoxazol-5-yl radical or a 2-hydroxymethylbenzoxazol-5-yl radical; X represents a CR10RH group; R8 represents hydrogen or C1-C4 alkyl or a fluorine atom or a chlorine atom or a bromine atom; RlO/Rl 1 represent hydrogen/2-methylthiazol-4-yl or hydrogen/2-pyridyl or hydrogen/2-methyloxazol-4-yl or hydrogen/2-aminomethylthiazol-4-yl or hydrogen/2-aminomethyloxazol-4-yl or hydrogen/2-hydroxymethylthiazol-4-yl or hydrogen/2-hydroxymethyloxazol-4-yl. As linkers of general formula (III), compounds are preferred in which V represents a bond or an aryl radical, o is equal to zero, and T represents an oxygen atom. As linkers of general formula (III), in addition compounds are preferred in which V represents a bond or an aryl radical or a group NR24b-C(=0)-0-(CH2)s (Formula Removed) ; Q represents a bond or a group (Formula Removed) ; and o is 0 to 4. Especially preferred are compounds (Formula Removed) of general formula (III), wherein V represents a bond or a group (Formula Removed) : Q represents a bond or a group (Formula Removed) ; o is equal to 0, 2 or 3; s is'equal to 1; and T is an oxygen atom. As linkers of general formula (IV), compounds are preferred in which o is zero to four, and q is zero to three. Especially preferred are compounds of general formula (IV), wherein o is 0, 2 or 3; W1 is an oxygen atom; q is equal to 0; R22 is hydrogen, C1-C3 alkyl or aralkyl; R23 is hydrogen or C1-C3 alkyl; R24ais hydrogen or Cj -C3 alkyl; R27 is fluorine, chlorine, CN, NO2, CO2 R28 or OR28; R28 is hydrogen or C1-C5 alkyl; and U is oxygen, CHR22 or CHR22-NR23-C(=O). As recombinant proteins for use as recognition units, for example, binding regions derived from antibodies, so-called CDRs, are suitable. As framework structures for use as recognition units, for example, high-molecular structures that are not derived from antibodies are suitable. For example, structures of the fibronectin type 3 and of crystallins can be mentioned. As fragments of monoclonal antibodies for use as recognition units, for example, single-chain Fv, Fab, F(ab)2 as well as recombinant multimers can be mentioned. As preferred recognition units, those are considered that are suitable for, for example, the recognition and/or diagnosis and/or therapy of solid tumors and malignant diseases of the hematopoietic system. As recognition units that are additionally preferred, those are considered that allow a selective recognition of the disease-specific vascular system, preferably of the angiogenesis. Table 1 cites examples of especially preferred recognition units for treating solid tumors. (Table Removed) As especially preferred recognition units for treating hematological tumors, antibodies or antibody fragments, such as CD 19. CD20, CD40, CD22, CD25, CD5, CD52, CD 10, CD2, CD7, CD33, CD38, CD40, CD72, CD4, CD21, CD5, CD37 and CD30, can also be mentioned. As especially preferred recognition units for anti-angiogenic therapy, antibodies or fragments thereof, such as VCAM, CD31, ELAM, endoglin, VEGFRI/II, αvß3, Tiel/2, TES23 (CD44ex6), phosphatidylserine, PSMA, VEGFR/VEGF complex or ED-B-fibronectin, can be mentioned. The compounds that are mentioned below are especially preferred according to the invention as effector elements: (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -methyl-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-l 3-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-l-methyl-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(E),7S,10R.HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentameihyl-3-fl-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S(E),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -methyl-vmyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S(E),7S,10R,llS,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-l-methyl-vinyl]-7,11 -dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5.,9,13-tetramethyl-16-[l-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -methyl-vinyl]-7-ethyl-5,5,9,13 -tetramethyl-oxacyclohexadec-13 -ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-l -methyl-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (1 S,3S(E),7S, 1 OR, 11 S, 12S, 16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S(E),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -methyl-vinyl]-10-ethyl-8,8,12,16-terramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (1 S,3S(E),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-l -methyl-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-fluoro-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -fluoro-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1 -fluoro-vinyl] -4,8-dihydroxy-5,5,7,9,13 -pentamethyl-oxacyclohexadec-13 -ene-2,6-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1 -fluoro-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -fluoro-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11 S, 12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-l -fluoro-vinyl]-7,l l~dihydroxy-8,8,10,12,16-pentamethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-chloro-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -chloro-vinylJ-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1 -chloro-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3-[l-chloro-2-(2-methyl-thiazol-4-yl)-vhiyl]-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11 S, 12S,16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -chloro-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)- 1 -chloro-vinyl]-7,l l-dihydroxy-8,8,10,12,16-pentamethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l-fluoro-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -fluoro-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec- 13-ene-2,6-dione, (4S,7R,8S,9S,13Z.16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-l-fluoro-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13 -ene-2,6-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l -fluoro-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5.,9-dione, (1 S,3 S(Z),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -fluoro-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclof 14.1.0]hepta-decane-5,9-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-l-fluoro-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l-chloro-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -chloro-vinyl] -7-ethyl-5,5,9,13 -tetramethyl-oxacyclohexadec-13 -ene-2,6-dione. (4S,7R,8S,9S, 13Z, 16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1 -chloro-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3 - [ 1 -chloro-2-(2-methyl-thiazol-4-yl) -vinyl] -4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -chloro-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[l 4.1.0]hepta-decane-5,9-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-l-chloro-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5.7,9,13-pentamethyl-16-[l-methyl-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(E),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-[l-methyl-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l-methyl-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(E),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3 -[ 1 -methyl-2-(2-pyridyl)-vinyl] -4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-fluoro-2-(2 -pyridyl)-vinyl] -oxacyclohexadec-13 -ene-2,6-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-[ 1 -fluoro-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo [ 14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-chloro-2-(2 -pyridyl)- vinyl]-oxacyclohexadec-13 -ene-2,6-dione, (1 S,3 S(Z),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3-[ 1 -chloro-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l -fluoro-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(Z),7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l-fluoro-2-(2-pyridyl)-vinyl]-4.17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z ,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l -chloro-2-(2 -pyridyl)- vinyl]-oxacyclohexadec-13-ene-2,6-dione, (1S,3S(Z),7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-10-ethyl-8,8512,16-tetramethyl-3-[ 1 -chloro-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -methyl -vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(E))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1 -methyl-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (1 S,3S(E),7S, 10R, 11S, 12S,16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3-[1 -methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S(E),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-l-methyl-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S(E),7S,10R,HS,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-l-methyl-vinyl]-7,l l-dihydroxy-8,8,10,12,16-pentamethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13 -ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -methyl-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(E)) 16-[2-(2-Aminomethyl-oxazol-4-yl)-1 -methyl-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(E),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S(E),7S, 1 OR, 11 S,12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -methyl-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[ 14.1.0]hepta-decane-5,9-dione, (lS,3S(E),7S,10R,HS,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-l-methyl-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[ 1 -fluoro-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-l -fluoro-vinylj-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-l-fluoro-vinyl] -4,8-dihydroxy-5,5,7,9,13 -pentamethyl-oxacyclohexadec-13 -ene-2,6-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-[ 1 -fluoro-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-l-fluoro-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo [ 14.1.0]heptadecane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11S, 12S, 16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1 -fluoro-vinyl]-7,l l-dihydroxy-8,8,10,12,16-pentamethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-chloro-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-l-chloro-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-l-chloro-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3-[l-chloro-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S(Z),7S,1 OR, 11 S,12S,16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -chloro-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (lS,3S(Z),7S,10R,llS,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-l-chloro-vinyl]-7,11 -dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-l 6-[l-fluoro-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-l-fluoro-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-l-fluoro-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l-fluoro-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -fluoro-vinylj-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-l -fluoro-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, 3 (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l-chloro-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -chloro-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-l -chloro-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13 -tetramethyl-oxacyclohexadec-13 -ene-2,6-dione, (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[ 1-chloro-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo [14.1.0] heptadecane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11S, 12S,16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -chloro-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (1 S,3S(Z),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)- 1-chloro-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9J3-pentamethyl-16-[2-(2-methyl-thiazol-4-yl)-vinyl] -oxacyclohexadec-13 -ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (1 S,3 S(E),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3-[2-(2-methyl-thiazol-4-yl)-vinyl] -4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione, (1 S,3 S(E),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (1 S,3 S(E),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-7,11 -dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2.6-dione, (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(E),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S(E),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-1O-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S(E),7S, 1 OR, 11 S, 12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione, (1 S,3S(E),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12 ,1 6-pentamethyl-3-[2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-l 6-[2-(2-pyridyl)-yinyl]-oxacyclohexadec-13-ene-2,6-dione, (lS,3S(E),7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[2-(2-pyridyl)-vinylJ-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2.6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-l 3-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-3-(2-hydroxymethyl-benzothiazol- 5 -yl)- 8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo [ 14.1. OJheptadecane-5,9-dione, (1 S,3 S,7S, 1 OR, 11 S, 12S, 16R)-3-(2-Aminomethyi-benzothiazol-5-yl)-7,l 1-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo [ 14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione. (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-l 3-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,llSa2S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S,7S,10R,llS,12S,16R)-7,ll-DihydroXy-3-(2-hydroxymethyl-benzothiazol-5-yl)-l O-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S,7S, 1 OR, 11S, 12S, 16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13 -ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-propyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (1 S,3 S,7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3 -(2-hydroxymethyl-benzothiazol-5-yl)-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S,7S, 1 OR, 11 S,l 2S, 16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11 -dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-butyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-butyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-l 0-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S,7S,1 OR, 11S, 12S, 16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11 -dihydroxy-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-allyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13 -ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10~allyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S,7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3 -(2-hydroxymethyl-benzothiazol-5-yl)-l O-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione, (1 S,3S,7S,1 OR, 11 S, 12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-1 O-allyl-8,8,12,16-tetramethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-prop-2-inyl-5,5,9,l 3-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13 -ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-DihydroXy-10-Prop-2-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S,7S,10R,HS,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,ll-dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4.17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-16-(2~methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z J 6S)-4,8-Dihydroxy~ 16-(2-hydroxymethyl-benzothiazol-5-yl)-7-but-3-enyl-5,5,9,13 -tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,l 7-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, ; - (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3 -(2-hydroxymethyl-benzothiazol-5-yl)-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S,7S, 1 OR, 11 S, 12S, 16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11 -dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-inyl-5,5,9J3-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-16-(2-Ammomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzotbia2;ol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (lS,3S,7S,10R,HS,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,H-dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-ben2;oxazol-5-yl)-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-16-(2-Ammomethyl-benzoxazol-5-yl)-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[ 14. ] .0]heptadecane-5,9-dione, (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-8,8,l 0,12,16-pentamethyl-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11 S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,l 1-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclof 14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (1 S,3 S,7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-ethyl-8,8,12,16-tetramethyl-4.17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (1 S,3S,7S, 1 OR, 11 S, 12S, 16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z.16S)-4,8-Dihydroxy-]6-(2-hydroxymethyl-benzoxazol-5-yl)-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS.12S,16R)-7,ll-Dihydroxy-10-propyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-propyl-8,8,12,16-tetramethy 1-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,l 1-dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo [14.1. OJheptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-butyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-7,11-Dihydroxy-10-butyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione, (1 S,3S,7S, 1 OR, 11 S, 12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11 -dihydroxy-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ally]-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-allyl-5,5,9,13-tetramethyl-oxacycloh.exadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-allyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[ 14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-1O-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11 -dihydroxy-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacydohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,nS,12S,16R)-7,ll-Dihydroxy-10-prop-2-inyl-8,8-,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5.9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3S,7S, 1 OR, 11 S, 12S, 16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-but-3-enyl-5,5,9,l 3-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-3-(2-Ammomethyl-benzoxazol-5-yl)-7,11 -dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy- 7-but-3-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13~ene-2,6-dione, (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-ben20xazol-5-yl)-4,8-dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione, (lS,3S,7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4, ] 7-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R,11SJ2S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, (1S,3S,7S,10R, 11 S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,l 1 -dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione. In a compound of general formula (I) according to the invention that contains one of the above-mentioned elements, the hydrogen atoms in the above-mentioned elements are replaced in the positions indicated in formula (I) by radicals L1-L3, wherein radicals L1-L3 have the above-indicated meanings. The invention also relates to linkers of general formula III1 (Formula Removed) in which RG1 can be an O=C=N group or an S=C=N group, and o, V, q and FG1 have the meanings that are already mentioned above, as well as linkers of general formula III (Formula Removed) in which RG2 can be a Hal-C(=T)~CHR22 group or a Hal-C(=T)-CHR22-NR23-C(=T) group or an R26-C(=O)-O-C(=T)-CHR22 group or an R26-C(=O)-O-C(=T)-CHR22-NR23-C(=T) group; R26 can be CI-CIQ alkyl, aryl, or aralkyl, and o, V, q, T and FG1 have the meanings that are already mentioned above, as well as linkers of general formula III3 (Formula Removed) in which RG3 can be an OH group or an NHR24a group or a COOH group, and o, V, q and FG1 have the meanings that are already mentioned above; but with the proviso that the compound l-(4-amino-phenyl)-pyrrole-2,5-dione is not included. The invention also relates to linkers of general formula (IV1): (Formula Removed) in which RG1 is an O=C=N group or an S=C=N group, and o, q, r, W2, R27, U and FG1 have the meanings that are mentioned in claim 1: or linkers of general formula (IV2): (Formula Removed) in which (Formula Removed) RG2 is a Hal-C(=T)-CHR22 group or a Hal-C(=T)-CHR22-NR23-C(=T) group or an R26-C(=O)-O-C(=T)-CHR22 group or an R26-C(=O)-O-C(=T)-CHR22-NR23-C(=T) group, wherein R26 is C1-C10 alkyl, aryl, or aralkyl, and R22, R23, T, o, q, r, (Formula Removed) W2, R , U and FG have the meanings that are mentioned in claim 1; or linkers of general formula (IV3): (Formula Removed) in which RG3 is an OH group or an NHR24a group or a COOH group, and R24a, o, q, r, W2, R27, U and FG1 have the meanings that are mentioned in claim 1. According to the invention, linkers of general formulas III1, III2 or III3 are preferred, wherein V represents a bond or an aryl radical, o is equal to zero, and T is an oxygen atom. In addition, linkers of general formulas III1 . III2 or III3 according to the invention are preferred, in which V represents a bond or an aryl radical or a group (Formula Removed) ; Q represents a bond or a group (Formula Removed) ; and o is 0 to 4. Especially preferred from the above are those linkers in which V represents a bond or a group (Formula Removed) ; Q represents a bond or a group (Formula Removed) ; o is equal to 0. 2 or 3; s is equal to 1; and T is an oxygen atom. In addition, preferred according to the invention are linkers of general formulas IV1, IV2 or TV3, in which o is zero to four and q is zero to three. Especially preferred from the above are those linkers in which o is 0. 2 or 3; W1 is an oxygen atom; q is equal to 0; R22 is hydrogen, C1-C3 alkyl or aralkyl: R23 is hydrogen or C1-C3 alkyl; R24a is hydrogen or C1-C3 alkyl; R27 is fluorine, chlorine, CN, NO2, CO2R28 or OR28; R28 is hydrogen or Ci-C5 alkyl; and U is oxygen, CHR22 or CHR22-NR23-C(=O). Additionally, the invention relates to methods to react a linker of general formula III1 or IV1 with a compound of general formula I, in which the condition that at least one group L1, L2 or L4 represent a linker need not be met, and in which L1 and/or L2 and/or L4 have the meaning of a hydrogen atom, and free hydroxyl groups and/or amino groups that are not required for the reaction optionally are protected, to react a linker of general formula III2 or IV2 with a compound of general formula I, in which the condition that at least one group L1, L2 or L4 represent a linker need not be met, and l1 and/or L2 and/or L4 have the meaning of a hydrogen atom, and free hydroxyl groups and/or amino groups that are not required for the reaction are optionally protected, or to react a linker of general formula III3 or IV3 with a compound of general formula I, in which the condition that at least one group L1, L2 or L4 represent a linker need not be met, and L1 and/or L2 and/or L4 have the meaning of a C(=O)Hal group or a C(=S)Hal group, and free hydroxyl groups and/or amino groups that are not required for the reaction are optionally protected. The invention also relates to the use of a compound of general formula I, wherein the substituents have the above-mentioned meanings, but the condition that at least one substituent L1, L2 or L4 represents a linker of general formula III or IV need not be met, and at least one substituent L1, L2 or L4 represents hydrogen, a group C(=O)C1, or a group C(S)C1, in a method as described above. The invention also relates to the use of a compound of general formula I, wherein the substituents have the above-mentioned meanings, but the condition that at least one substituent L1, L2 or L4 represent a linker of general formula III or IV need not be met, and at least one substituent L1, L2 or L4 represents hydrogen, a group C(=O)C1, or a group C(S)C1, for the production of an effector recognition unit conjugate as described above. The invention also relates to the use of a linker of general formula III1, III2, III3, IV1, IV2 or IV3 for the production of an effector conjugate, as described above. The invention also relates to the use of a linker of general formula III , III , III , IV1, IV2 or IV3 for the production of an effector recognition unit conjugate as described above. The invention also relates to the use of a recognition unit, as described above, in a process according to the invention for the production of an effector recognition unit conjugate, as described above. The invention also relates to the effector recognition unit conjugates according to the invention for use as a medicament or for the production of a medicament or a pharmaceutical composition. The invention relates finally to the use of the effector recognition unit conjugates according to the invention for the production of medicaments for the treatment of diseases that are associated with proliferative processes, such as tumors, inflammatory and/or neurodegenerative diseases, multiple sclerosis, Alzheimer's disease, or for the treatment of angiogenesis-associated diseases, such as tumor growth, rheumatoid arthritis or diseases of the ocular fundus. rtor-Examples of the Synthesis of Linkers (L) Example LI (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-propanoic acid Example LI a (S) 2-[(3-Acetylsulfanyl-propionyl)-methyl-aminoJ-propanoic acid ethyl ester The solution of 15 g (89.5 mmol) of N-methylalanine ethyl ester-hydrochloride in 850 ml of anhydrous tetrahydrofuran is mixed at 23 °C with 4.1 g of an approximately 60% sodium hydride dispersion and, after 3 hours, with 23.5 g of 3-acetylsulfanyl-propanoic acid chloride. It is allowed to react for two days, mixed with saturated sodium bicarbonate solution, and extracted several times with ethyl acetate. The combined organic extracts are washed with saturated sodium chloride solution, dried over sodium sulfate, and the residue that is obtained after filtration and removal of the solvent is purified by chromatography on fine silica gel. 17.6 g (67.3 mmol.,. • 75%) of the title compound is isolated as a colorless oil. Example Lib (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-propanoic acid The solution of 17.6 g (67.3 mmol) of the compound prepared according to Example LI a in 150 ml of methanol is mixed at 23°C with 44 ml of a 5M sodium hydroxide solution, and it is stirred for 5 hours. By adding 4N hydrochloric acid, a pH of 2 is set, and it is extracted with dichlorometharie. The combined organic extracts are washed with saturated sodium chloride solution and dried over sodium sulfate. The residue that is obtained after filtration and removal of the solvent (13.0 g, maximum 67.3 mmol) is further reacted without purification. Example L1c (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-propanoic acid methyl ester The solution of 4.53 g (maximum 23.7 mol) of the crude product, prepared according to Example LI b, in 135 ml of diethyl ether is esterified at 0°C with an ethereal solution of diazomethane. After removal of the solvent, 4.59 g (22 A mmol, 94%) of the title compound is isolated as a pale yellow oil, which is further reacted without purification. Example Lid (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-arninoJ-propanoic acid methyl ester The solution of 14 g (68.2 mmol) of the compound, prepared according to Example Lie, in 180 ml of trichloromethane is added to the solution of 21 g of 2-methyldisulfanyl-isoindole-l,3-dione in 420 ml of trichloromethane, and it is stirred for 16 hours at 23°C. It is concentrated by evaporation, dissolved in dichloromethane, and stirred for 0.5 hour. Solid is filtered off, the filtrate is concentrated by evaporation, and the residue is purified by chromatography on fine silica gel. 16.2 g (57.2 mmol, 84%) of the title compound is isolated as a colorless oil. Example LI (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amirio]-propanoic acid The solution of 10 g (35.3 mmol) of the compound, prepared according to Example Lid, in 20 ml of ethanol is mixed with 1 1 of phosphate puffer with a pH of 7, pig liver esterase, and it is incubated at 27°C for 46 hours. By adding a 4N hydrochloric acid, the pH is adjusted to 1, it is extracted with dichloromethane, dried over sodium sulfate, and after filtration and removal of the solvent, 8.3 g (30.8 mmol, 87%) of the title compound is isolated as a colorless oil, which is reacted without further purification. 1H-NMR (CDC13): δ = 1.43+1.51 (3H), 2.55+2.63 (3H), 2.87 (2H), 2.88+3.00 (3H), 3.08-3.26 (2H), 4.63+5.19 (1H), 7.90 (1H) ppm. Example L2 [(3 -Methyltrisulfanyl-propionyl)-methyl-amino] -acetic acid Example L2a 2-[(3-Acetylsulfanyl-propionyl)-methyl-amino]-acetic acid ethyl ester 7.13 g (46.4 mmol) of N-methylglycine ethyl ester-hydrochloride is reacted analogously to Example LI a, and 6.9 g (27.9 mmol, 60%) of the title compound is isolated as a colorless oil. Example L2b [(3 -Mercapto-propionyl)-methyl-amiBo] -acetic acid 7.6 g (30.7 mmol) of the compound that is prepared according to Example L2a is reacted analogously to Example Lib, and 4.92 g (27.8 mmol, 90%) of the title compound is isolated as a colorless oil. Example L2c [(3-Mercapto-propionyl)-methyl-amino]-acetic acid methyl ester 4.92 g (27.8 mmol) of the compound that is prepared according to Example L2b is reacted analogously to Example Lie, and 5.01 g (26.2 mmol, 94%) of the title compound is isolated as a colorless oil. Example L2d [(3-Methyltrisulfanyl-propionyl)-methyl-aminoJ-acetic acid methyl ester 2.00 g (10.5 mmol) of the compound that is prepared according to Example L2c is reacted analogously to Example Lid, and 2.33 g (8.65 mmol, 82%) of the title compound is isolated as a colorless oil. Example L2 [(3 -Methyltrisulfanyl-propionyl)-methyl-amino] -acetic acid 2.00 g (7.83 mmol) of the compound that is prepared according to Example L2d is reacted analogously to Example LI, and 0.64 g (2.51 mmol, 32%) of the title compound is isolated as a colorless oil. 1H-NMR (CDC13): δ = 2.41+2.56 (3H), 2.61-3.27 (7H), 3.98 (2H), 4.38 (1H) ppm. Example L3 (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-ammo]-3-phenyl-propionic acid Example L3a (S) 2-[(3-Acetylsulfanyl-propionyl)-methyl-amino]-3-phenyl-propanoic acid ethy] ester 7.73 g (31.7 mmol) of N-methylphenylaJanine ethyl ester-hydrochloride is reacted analogously to Example Lla, and 2.3 g (6.82 mmol, 22%) of the title compound is isolated as a colorless oil. Example L3b (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-3-phenyl-propanoic acid 1.09 g (3.23 mmol) of the compound that is prepared according to Example L3a is reacted analogously to Example Lib, and 0.744 g (2.78 mmol, 86%) of the title compound is isolated as a colorless oil. Example L3c (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-3-phenyl-propanoic acid methyl ester 0.74 g (2.77 mmol) of the compound that is prepared according to Example L3b is reacted analogously to Example Lie, and 0.77 g (2.74 mmol, 99%) of the title compound is isolated as a colorless oil. Example L3d (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-3-phenyl-propanoic acid methyl ester 0.77 g (2.74 mmol) of the compound that is prepared according to Example L3c is reacted analogously to Example Lid, and 0.72 g (2.00 mmol, 73%) of the title compound is isolated as a colorless oil. Example L3 (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-3-phenyl-propanoic acid 0.72 g (2.00 mmol) of the compound that is prepared according to Example L3d is reacted analogously to Example LI, and 0.49 g (1.42 mmol, 71%) of the title compound is isolated as a colorless oil. Example L4 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 20.0 g (193.9 mmol) of 4-aminobutyric acid is mixed with 19 g of maleic acid anhydride, 290 ml of acetic acid, and it is heated for 4 hours in an oil bath at 130°C. It is azeotropically concentrated by evaporation with repeated addition of toluene, the residue is dissolved in dichloromethane and purified by chromatography on fine silica gel. 17.1 g (93.4 mmol, 48%) of the title compound is isolated as a crystalline solid. 1H-NMR (CDC13): δ = 1.93 (2H), 2.38 (2H), 3.60 (2H), 6.71 (2H) ppm. Example L4a l-(3-Isocyanato-propyl)-pyrrole-2,5-dione 5.0 g (27.3 mmol) of the compound that is prepared according to Example L4 is dissolved in 90 ml of tetrahydrofuran, mixed with 8 ml of triethylamine and 6.17 ml of phosphoric acid diphenylester azide, and it is stirred for 1.5 hours at 23°C. Then, it is mixed with 110 ml of toluene, the tetrahydrofuran is distilled off, and it is heated for 2 hours to 70°C. The crude product is purified by chromatography on fine silica gel. 1.77 g (9.82 mmol, 36%) of the title compound is isolated. Example L5 6-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-hexanoic acid 100 g (762 mmol) of 6-aminocaproic acid is reacted analogously to Example L5, and 93.8 g (444 mmol, 58%) of the title compound is isolated as a crystalline solid. 1H-NMR (CDC13): δ = 1.34 (2H), 1.55-1.70 (4H), 2.34 (2H), 3.51 (2H), 6.69 (2H)ppm. Example L5a l-(5-Isocyanato-pentyl)-pyrrole-2,5-dione 10.0 g (47.3 mmol) of the compound that is prepared according to Example L5 is reacted analogously to Example L4a, and 3.19 g (15.3 mmol, 32%) of the title compound is isolated as a colorless oil. Example L6 1 l-(2,5-Dioxo-2,5-dihydro-pynol-l-yl)-undecanoic acid 10 g (49.7 mmol) of 11-aminoundecanoic acid is reacted analogously to Example L5, and 6.29 g (22.4 mmol, 45%) of the title compound is isolated as a crystalline solid. 1H-NMR(CDCl3): δ = 1.19-1.36 (12H), 1.51-1.67 (4H), 2.34 (2H), 3.49 (2H)5 6.68 (2H) ppm. Example L6a 1 -(10-Isocyanato-decyl)-pyrrole-2,5-dione 5.28 g (18.8 mmol) of the compound that is prepared according to Example L6 is reacted analogously to Example L4a, and 3.37 g (12.1 mmol, 64%) of the title compound is isolated as a colorless oil. Example L7 l-(4-Amino-phenyl)-pyrrole-2,5-dione The solution of 21.6 g (200 mmol) of 1,4-phenylenediamine in 200 ml of tetrahydrofuran is mixed over 1.5 hours with the solution of 19.6 g of maleic acid anhydride, and it is stirred for 22 hours at 23 °C. It is filtered, rewashed with tetrahydrofuran, and the filtrate is dried. 37.1 g (197 mmol, 98%) of the title compound is isolated as a crystalline solid. 1H-NMR (d6-DMSO): δ = 6.28 (1H), 6.48 (1H), 6.53 (2H), 7.30 (2H), 7.50-9.00 (2H) ppm. Example L8 l-(4-Hydroxy-phenyl)-pyrrole-2,5-dione The suspension that consists of 5.0 g (45.8 mmol) of 4-aminophenol, 4.49 g of maleic acid anhydride and 40 ml of acetic acid is refluxed for 3 hours. It is concentrated by evaporation, residual acetic acid is removed azeotropically by repeated distillation with acetic acid, and the residue is purified by chromatography on fine silica gel. 2.83 g (15.0 mmol, 33%) of the title compound is isolated. 1H-NMR (d6-DMSO): δ = 6.83 (2H), 7.09 (2H), 7.13 (2H), 9.71 (1H) ppm. Example L9 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l -yl)-butanoic acid 4-hydroxymethyl-2-nitro-phenyl ester The solution of 5.0 g (29.6 mmol) of 4-hydroxymethyl-2-nitro-phenol in 250 ml of dichloromethane is mixed with 6.1 g of N.N'-dicyclohexylcarbodiimide and 2.4 ml of pyridine, and the solution of 5.5 g of the compound, prepared according to Example L4, in 250 ml of dichloromethane, is added dropwise within 15 minutes. It is stirred for one more hour at 23 °C, filtered, the filtrate is concentrated by evaporation and purified by chromatography on fine silica gel. 1.73 g (5.2 mmol, 18%) of the title compound is isolated. 1H-NMR (CDC13): δ = 2.07 (3H), 2.67 (2H), 3.67 (2H), 4.79 (2H), 6.72 (2H), 7.28 (1H), 7.66 (1H), 8.10 (IH)ppm. Example LI 0 6-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-hexanoic acid 4-hydroxymethyl-2-nitro-phenyl ester Analogously to Example L9, 5.0 g (29.6 mmol) of 4-hydroxymethyl-2-nitro-phenol is reacted with 6.34 g of the compound that is prepared according to Example L5, and after working-up and purification, 3.78 g (10.4 mmol, 35%) of the title compound is isolated. 1H-NMR (CDC13): δ = 1.42 (2H), 1.66 (2H), 1.88 (2H), 2.64 (2H), 3.55 (2H), 4.78 (2H), 6.69 (2H), 7.21 (1H), 7.64 (1H), 8.09 (1H) ppm. Example Lll 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-hydroxymethyl-2-nitro- phenyl ester Analogously to Example L9, 5.0 g (29.6 mmol) of 4-hydroxymethyl-2-nitro-phenol is reacted with 8.44 g of the compound that is prepared according to Example L6, and after working-up and purification, 3.78 g (10.4 mmol, 35%) of the title compound is isolated. 1H-NMR (CDCl3): δ = 1.21-1.63 (14H). 1.76 (2H), 1.99 (1H), 2.63 (2H). 3.51 (2H), 4.78 (2H), 6.68 (2H), 7.21 (1H), 7.65 (1H), 8.10 (1H)ppm. Example L12 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-hydroxymethyl-phenyl ester 5.5 g (23,1 mmol) 4-tert-Butyldimethylsilanyloxymethyl-phenol, 20 mg N,N-Dimethyl-4-aminopyridine und 4.23 g (23,1 mmol) of the compound prepared according to Example L4 are dissolved in 92 ml of dichloromethane and cooled to 0°C. 4.77 g (23.1 mmol) N,N'-Dicyclohexylcarbodiimide in 24 ml dichloromethane are added dropwise to the cooled solution over a period of 15 min. The mixture is stirred for 16 hours at 23 °C, filtered, the filtrate is concentrated and purified by chromatography on fine silica gel. 7.18 g (17.8 mmol. 77%) 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid-4-tert-butyldimethylsilanyloxymethyl-phenyl ester are isolated. 1.42 g thereof are dissolved in 63 ml THF and 7 ml water, and 0.67g (3.52 mmol) p-toluenesulfonic acid are added at room temperature. After 16 hours, a saturated sodium bicarbonate solution is added and the mixture is extracted several times with ethyl acetate. The combined organic layers are washed with a saturated solution of sodium chloride, dried over sodium sulfate and purified by chromatography on fine silica gel. 0.43 g (1.5 mmol, 42%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.71 (1H), 2.04 (2H). 2.58 (2H), 3.67 (2H), 4.68 (2H), 6.71 (2H), 7.09 (2H), 7.38 (2H) ppm. Example L13 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-hydroxymethyl-phenyl ester Analogously to Example L12, 4.02 g (13.8 mmol) 4-tert- buryldimethylsilanyloxymethyl- phenol are reacted with 3.56 g (13.8 mmol) of the compound prepared according to Example L5. After working-up, purification and analogous treatment with p-toluenesulfonic acid, 3,19 g (10.1 mmol, 60%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.42 (2H), 1.59-1.83 (SEl 2.55 (2H), 3.55 (2H), 4.68 (2H), 6.69 (2H), 7.06 (2H), 7.38 (2H) ppm. Example L14 1 l-(2.5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-hydroxymethyl-phenyl ester Analogously to Example L12, 5.41 g (22.7 mmol) 4-tert- butyldimethylsilanyloxymethyl- phenol are reacted with 6.39 g (22.7 mmol) of the compound prepared according to Example L6. After working-up, purification and analogous treatment with p-toluenesulfonic acid, 5.91 g (15.3 mmol, 67%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.24-1.43 (12H), 1.57 (3H), 1.74 (2H), 2.55 (2H), 3.50 (2H), 4.69 (2H), 6.68 (2H), 7.06 (2H), 7.38 (2H) ppm. Example LI5 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-hydroxymethyl-2-chloro- phenyl ester Analogously to Example L9, 5.0 g (29.6 mmol) of 4-hydroxymethyl-2-chloro-phenol are reacted with 5.42 g of the compound prepared according to Example L4. After working-up and purification, 8.49 g (26.2 mmol, 89%) of the title compound are isolated. 1H-NMR (CDC13): δ = 2.07 (3H), 2.64 (2H), 3.67 (2H), 4.67 (2H), 6.72 (2H), 7.14 (1H), 7.27 (1H), 7.46 (1H) ppm. Example LI 6 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-hydroxymethyl-2-chloro- phenyl ester Analogously to Example L9, 5.0 g (29.6 mmol) of 4-hydroxymethyl-2-chloro-phenol are reacted with 6.24 g of the compound prepared according to Example L5. After working-up and purification, 5.11 g (14.5 mmol, 49%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.43 (2H), 1.66 (2H), 1.81 (3H), 2.61 (2H), 3.55 (2H), 4.67 (2H), 6.69 (2H), 7.10 (1H), 7.26 (1H), 7.46 (1H) ppm. Example LI7 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-hydroxymethyl-2-chloro- phenyl ester Analogously to Example L9, 4.61 g (29 mmol) 4-hydroxymethyl-2-chloro-phenol are reacted with 8.17 g of the compound prepared according to Example L6. After working-up and purification, 4.61 g (10.9 mmol, 38%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.18-1.84 (17H), 2.61 (2H), 3.51 (2H), 4.67 (2H), 6.68 (2H), 7.10 (1H), 7.27 (1H), 7.46 (lH)ppm. Example LI 8 l-(6-Hydroxy-hexyl)-pyrrol-2,5-dione 26 ml of a 1 ,OM solution of borane-tetrahydrofurane-complex in tetrahydrofurane is added to a solution of 5.0 g (23.7 mmol) of the acid prepared according to Example L5 in 50 ml of anhydrous tetrahydrofurane and the mixture is stirred for 3 hours at 23°C. The mixture is poured into a saturated solution of sodium bicarbonate, extracted several times with ethyl acetate, and the combined organic extracts are dried over sodium sulfate. After filtration and removal of the solvent, the residue is purified by chromatography. 2.53 g (12.8 mmol, 54%) of the title compound are isolated. 1H-NMR (CDC13): δ= 1.24-1.65 (9H), 3.52 (2H), 3.63 (2H), 6.68 (2H) ppm. Examples of the Synthesis of Effector-Linker Conjugates (EL) Example ELI (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-propyl]-carbamicacid-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester Example EL la (4S,7R,8S,9S,13Z,16S)-7-Allyl-8-(tert-butyl-dimethyl-silanyloxy)-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione The solution of 6.0 g (7.93 mmol) of (4S,7R,8S,9S,13Z,16S)-7-allyl-4,8-bis(rert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, which was produced analogously to the process that is described in WO 00/66589, in ] 86 ml of anhydrous dichloromethane is mixed at 0°C with 26.4 ml of a 20% solution of trifluoroacetic acid in dichloromethane, and it is stirred for 6 hours at 0°C. It is poured into saturated sodium bicarbonate solution, extracted with dichloromethane, the combined organic extracts are washed with water and dried over magnesium sulfate. The residue that is obtained after filtration and removal of the solvent is purified by chromatography on fine silica gel. 3.32 g (5.17 mmol, 65%) of the title compound is isolated as a colorless solid. 1H-NMR (CDC13): δ = 0.09 (3H), 0.12 (3H), 0.93 (9H), 1.00 (3H), 1.06 (3H), 1.22 (3H), 1.70 (3H), 1.03-1.77 (5H), 1.95 (1H), 2.31-2.56 (6H), 2.83 (3H), 2.87 (1H), 3.00 (1H), 3.30 (1H), 3.90 (1H), 4.09 (1H), 4.94-5.03 (2H), 5.20 (1H), 5.77 (1H), 5.88 (1H), 7.34 (1H), 7.78 (1H), 7.95 (1H) ppm. Example ELlb (4S,7R,8S,9S,13Z,16S)-3-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-propyl]-carbamicacid-7-allyl-8-tert-butyl-dimethylsilyloxy-5,5,9,13-tetramemyl-16-(2-memyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-l3-en-4-yl ester 50 mg (78 µmol) of the compound that is prepared according to Example EL la is dissolved in a mixture of 1.5 ml of trichloromethane and 1.5 ml of dimethylformamide, mixed with 144 mg of the linker that is prepared according to Example L4a, 79 mg of copper(I) chloride, and it is heated for 18 hours to 70°C. The crude mixture is purified by chromatography on thin-layer plates, and 51 mg (62 µmol, 80%) of the title compound is isolated as a colorless oil. Example ELI (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-propyl]-carbamicacid-7-allyl-8-hydroxy-5,5,9.13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester The solution of 41 mg (50 µmol) of the compound, prepared according to Example Ib, in a mixture of 0.8 ml of tetrahydrofuran and 0.8 ml of acetonitrile is mixed with 310 fil of hexafluorosilicic acid, 310 µl of hydrogen fluoride-pyridine complex, and it is stirred for 23 hours at 23°C. It is poured into a 5% sodium hydroxide solution, extracted with ethyl acetate, the combined organic extracts are washed with a saturated sodium chloride solution and dried over sodium sulfate. The residue that is obtained after filtration and removal of the solvent is purified by chromatography on thin-layer plates, and 26 mg (36.7 µmol, 73%) of the title compound is isolated as a colorless foam. 1H-NMR (CDC13): δ = 0.99 (3H), 1.14(3H), 1.17(3H), 1.20-1.51 (3H), 1.54-1.87 (6H), 1.70 (3H), 2.22 (1H), 2.28-3.02 (9H), 2.83 (3H), 3.31 (1H), 3.45 (1H), 3.68 (1H), 4.44+4.83 (1H), 4.99 (1H), 5.03 (1H), 5.15 (1H), 5.61 (1H), 5.72 (1H), 5.91 (1H), 6.68 (2H), 7.36 (1H), 7.78 (1H), 7.90 (1H) ppm. Example EL2 (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-propyl]-carbamic acid-10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (A) and (lR,3S,7S,10R,HS,12S,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-propyl]-carbamic acid-10-allyl-1 l-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (B) The solution of 44 mg (62.2 µmol) of the compound, prepared according to Example 1, in 2.0 ml of dichloromethane is cooled to -50°C and mixed in portions over a period of 1.5 hours with a total of 1.7 ml of an approximately 0.1 M solution of dimethyl dioxiran in acetone. It is poured into a saturated sodium thiosulfate solution, extracted with dichloromethane, and the combined organic extracts are dried over sodium sulfate. The residue that is obtained after filtration and removal of the solvent is purified by chromatography on thin-layer plates, and 22.7 mg (31.4 uxnol, 50%) of title compound A as well as 7.6 mg (10.5 u.mol, 17%) of title compound B are isolated in each case as a colorless foam. 1H-NMR (CDC13) of A: δ= 1.01 (3H). ] .14 (3H), 1.16 (3H), 1.20-1.94 (8H), 1.32 (3H), 2.11-2.74 (9H), 2.82 (1H), 2.84 (3H). 3.30 (2H), 3.48 (2H), 3.68 (1H), 4.36+4.93 (1H), 4.99 (1H), 5.04 (1H), 5.54 (1H), 5.69 (1H), 6.05 (1H), 6.68 (2H), 7.32 (1H), 7.80 (1H), 7.88 (1H) ppm. 1H-NMR (CDC13) of B: δ= 1.02 (6H), 1.26 (3H), 1.33 (1H), 1.23-2.27 (12H), 2.54-2.78 (4H), 2.82 (3H), 2.91 (1H), 3.13 (1H), 3.40 (2H), 3.66 (1H), 4.11 (1H), 4.84 (1H), 4.95 (1H), 5.01 (1H), 5.70 (1H), 5.81+5.93 (1H), 6.04+6.13 (1H), 6.69 (2H), 7.35 (1H), 7.75 (1H), 7.90+7.99 (1H) ppm. Example EL3 (4S,7R,8S,9S, 13Z, 16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-pentyl]-carbamic acid-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester Example EL3a (4S,7R,8S,9S, 13Z, 16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-pentyl]-carbamic acid- 7-allyl-8-tert-bu1yl-dmiethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-berizothiazol- 5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 50 mg (78 µmol) of the compound that is prepared according to Example EL la is reacted analogously to Example ELlb with the linker that is produced according to Example L5a, and after purification, 39 mg (45.9 µmol, 59%) of the title compound is isolated as a colorless oil. Example EL3 (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-pentyl]-carbamicacid-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-4-yl ester 84 mg (98.8 µmol) of the compound that is prepared according to Example EL3a is reacted analogously to Example ELL and after purification, 43 mg (58.4 µmol, 59%) of the title compound is isolated as a colorless foam. 1H-NMR (CDC13): δ = 0.89 (3H), 0.96 (3H), 0.85-1.97 (17H), 1.12 (3H), 2.16-3.01 (10H), 2.82 (3H), 3.44 (1H), 3.65 (1H), 4.41+4.53 (1H), 4.98 (1H), 5.03 (1H), 5.15 (1H), 5.60 (1H), 5.71 (1H), 5.90 (1H), 6.68 (2H), 7.35 (1H), 7.77 (1H), 7.89+7.96 (lH)ppm. Example EL4 (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-pentyl]-carbamic acid-10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3 -(2-methyl-benzothiazol-5-yl)-5,9- dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (A) and (1R,3S,7S,1 OR, 11 S,12S, 16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l -yl)-pentyl]-carbamic acid-10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3 -(2-methyl-benzothiazol-5-yl)-5,9- dioxo-4,17-dioxabicyc!o[14.1.0]heptadec-7-yl ester (B) 26 mg (35.3 µmol) of the compound that is prepared according to Example EL3 is reacted analogously to Example EL2, and after purification, 9.1 mg (12.1 µmol, 34%) of title compound A as well as 3.0 mg (4.0 µmol, 11%) of title compound B are isolated in each case as a colorless foam. 1H-NMR (CDC13) of A: δ= 0.83-1.94 (ISH), 0.98 (3H), 1.14 (3H), 1.16 (3H), 1.32 (3H), 2.15-2.82 (8H), 2.84 (3H), 3.44 (2H), 3.51 (1H), 3.66 (1H), 4.46 (1H), 4.99 (1H), 5.04 (1H), 5.54 (1H), 5.69 (1H), 6.06 (1H), 6.68 (2H), 7.33 (1H), 7.80 (1H), 7.89 (IH)ppm. 1H-NMR (CDC13) of B: δ = 0.78-2.74 (23H), l.Ol (3H), 1.03 (3H), 1.33 (3H), 2.82 (3H), 2.91 (1H), 3.14 (1H), 3.39 (1H), 3.47 (2H), 3.67 (1H), 4.12 (1H), 4.49 (1H), 4.92-5.06 (2H), 5.53+5.80 (1H), 5.69 (1H), 6.11 (1H), 6.68 (2H), 7.34 (1H), 7.74+7.79 (1H), 7.89+8.02 (1H) ppm. Example ELS (4S,7R,8S,9S,13Z,16S)-[10-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-decyl]-carbamic acid-7-allyl-8-hydroxy-5,5,9.13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester Example EL5a (4S,7R,8S,9S,13Z,16S)-[10-(255-Dioxo-2,5-dihydro-pyrrol-l-yl)-decyl]-carbainic acid-7-allyl-8-rert-butyl-dimethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-l3-en-4-yl ester 50 mg (78 µmol) of the compound that is prepared according to Example ELla is reacted analogously to Example ELlb with the linker that is produced according to Example L6a, and after purification, 56 mg (60.8 µmol, 78%) of the title compound is isolated as a colorless oil. Example ELS (4S,7R,8S,9S, 13Z, 16S)-[ 10-(2,5-Dioxo-2,5-dihydro-pyrrol-l -yl)-decyl]-carbamic acid-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6- dioxo-oxacyclohexadec-13-en-4-yl ester 20 mg (21.7 µmol) of the compound that is prepared according to Example EL5a is reacted analogously to Example ELI, and after purification, 10 mg (12.4 µmol, 57%) of the title compound is isolated as a colorless foam. 1H-NMR (CDC13): δ = 0.91-1.87 (22H), 0.97 (3H), 1.13 (3H), 1.17 (3H), 1.70 (3H), 2.18-2.69 (8H), 2.80 (1H), 2.82 (3H), 2.96 (1H), 3.47 (1H), 3.50 (2H), 3.66 (1H), 3.97+4.36 (1H), 4.98 (1H), 5.04 (1H), 5.16 (1H), 5.61 (1H), 5.72 (1H), 5.91 (1H), 6.68 (2H), 7.37 (1H), 7.77 (1H), 7.90+7.97 (1H) ppm. Example EL6 (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-[10-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-decyl]- carbamic acid-10-allyl-l 1 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5- yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (A) and (1R,3 S,7S, 1 OR, 11 S, 12S, 16S)-[ 10-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-decyl]- carbamic acid-10-allyl-l l-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5- yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (B) 18 mg (22 µmol) of the compound that is prepared according to Example EL5 is reacted analogously to Example EL2, and after purification, 9.2 mg (11.2 µmol, 51%) of title compound A as well as 3.2 mg (3.9 µmol, 18%) of title compound B are isolated in each case as a colorless foam. 1H-NMR (CDC13) of A: δ = 0.98 (3H), 1.14 (3H), 1.16 (3H), 1.32 (3H), 1.03-1.67 (21H), 1.71-1.94 (3H), 2.18-2.78 (9H), 2.83 (3H), 3.50 (3H), 3.66 (1H), 3.87+4.43 (1H), 4.98 (1H), 5.04 (1H), 5.53 (1H). 5.69 (1H), 6.07 (1H), 6.68 (2H), 7.33 (1H), 7.80 (1H), 7.89+7.93 (1H) ppm. 1H-NMR (CDC13) of B: δ = 0.80-1.64 (21H), 1.01 (3H), 1.03 (3H), 1.25 (3H), 1.33 (3H), 1.79-2.25 (5H), 2.34+3.14 (1H), 2.52-2.76 (4H), 2.81 (3H), 2.91 (1H), 3.40 (1H), 3.51 (2H), 3.67+3.82 (1H), 4.13+4.26 (1H), 4.46 (1H), 4.94 (1H), 5.01 (1H), 5.70 (1H), 5.81+5.94 (1H), 6.05+6.12 (1H), 6.68 (2H), 7.36 (1H), 7.74 (1H), 7.91+8.02 (1H) ppm. Example EL7 (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-propyl]-carbamicacid-7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en- 8 -yl ester Example EL7a (4S,7R,8S,9S, 13Z, 16S)-7-Allyl-4-(tert-butyl-dimethyl-silanyloxy)-8-hydroxy- 5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6- dione The solution of 5.3 g (7.01 mmol) of (4S ,7R,8S,9S,13Z,16S)-7-allyl-4,8-bis(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione, which was produced analogously to the process described in WO 00/66589, in a mixture of 85 ml of tetrahydrofuran and 85 ml of acetonitrile, is mixed with 31.7 ml of hexafluorosilicic acid, cooled to 0°C, 8.1 ml of trifluoroacetic acid is added dropwise, and it is stirred for 20 hours at 0°C. It is poured into water, neutralized by adding a saturated sodium bicarbonate solution and extracted several times with ethyl acetate. The combined organic extracts are washed with saturated sodium chloride solution, dried over sodium sulfate, and the residue that is obtained after filtration and removal of the solvent is purified by chromatography on fine silica gel. 2.82 g (4.39 mmol, 63%) of the title compound is isolated as a colorless solid. 1H-NMR (CDC13): δ = -0.09 (3H), 0.08 (3H), 0.84 (9H), 1.08 (3H), 1.10 (3H), 1.12 (3H), 1.21-1.86 (5H), 1.70 (3H), 2.15 (1H), 2.29-2.97 (8H), 2.84 (3H), 3.14 (1H), 3.96 (1H), 4.03 (1H), 4.97-5.06 (2H), 5.23 (1H), 5.61 (1H), 5.77 (1H), 7.35 (1H), 7.79 (1H), 7.93(lH)ppm. Example EL7b (4S,7R,8S,9S, 13Z, 16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-propyl]-carbamic acid-7-allyl-4-tert-butyl-dimethylsilyloxy-5,5,9,13 -tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec- 13-en-8-y] ester 100 mg (156 µmol) of the compound that is prepared according to Example EL7a is reacted analogously to Example ELlb with the linker that is produced according to Example L4a, and after purification, 121 mg (147 µmol, 94%) of the title compound is isolated as a colorless oil. Example EL7 (4S,7R,8S,9S, 13Z, 16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-propyl]-carbamic acid- 7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-8-yl ester 46 mg (56 µmol) of the compound that is prepared according to Example EL7b is reacted analogously to Example ELI, and after purification, 17 mg (24 µmol, 43%) of the title compound is isolated as a colorless foam. 1H-NMR (CDC13): δ = 0.99-1.30 (2H), 1.03 (3H), 1.07 (3H), 1.21 (3H), 1.51-1.97 (6H), 1.72 (3H), 2.27-2.61 (6H), 2.83 (3H). 2.88 (1H), 3.09 (1H), 3.14 (2H), 3.51 (1H), 3.58 (2H), 4.04 (1H), 4.96-5.04 (2H), 5.12 (1H), 5.19 (1H). 5.28 (1H), 5.75 (1H), 5.86 (1H), 6.66 (2H), 7.35 (1H), 7.78 (1H), 7.96 (1H) ppm. Example EL8 (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-propyl]-carbamic acid-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-l 1-yl ester (A) and (1 S,3S,7S, 1 OR, 11 S, 12S, 16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-propylj-carbamic acid-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]-heptadec-l 1-yl ester (B) 29 mg (41 µmol) of the compound that is prepared according to Example EL 7 is reacted analogously to Example EL2, and after purification, 18 mg (24.9 µmol, 61%) of title compound A as well as 3.0 mg (4.1 µmol, 10%) of title compound B are isolated in each case as a colorless foam. 1H-NMR (CDC13) of A: δ= 0.98 (3H), 1.05 (3H), 1.24 (3H), 1.26 (3H), 1.12-1.83 (9H), 2.12-2.46 (4H), 2.59 (2H), 2.76 (1H), 2.84 (3H), 3.14 (2H), 3.59 (3H), 3.98 (1H), 4.10 (1H), 4.95-5.02 (2H), 5.17 (2H), 5.77 (1H), 6.19 (1H), 6.70 (2H), 7.38 (1H), 7.82 (1H), 7.97 (IH)ppm. 1H-NMR(CDCl3)ofB: δ = 0.96(3H), 1.01 (3H), 1.13-1.86 (11H), 1.28 (3H), 1.32 (1H), 2.16-2.50 (6H), 2.84 (3H), 3.02 (1H), 3.15 (2H), 3.50 (1H), 3.61 (2H), 3.88 (1H), 4.19 (1H), 4.96-5.04 (2H), 5.13 (1H), 5.28 (1H), 5.78 (1H), 6.33 (1H), 6.71 (2H), 7.36 (1H), 7.81 (1H), 7.96 (1H) ppm. Example EL9 (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-pentyl]-carbamicacid-7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester Example EL9a (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-pentyl]-carbamicacid-7-allyl-4-tert-butyl-dimethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 100 mg (156 µmol) of the compound that is prepared according to Example EL7a is reacted analogously to Example ELlb with the linker that is produced according to Example L5a, and after purification, (65.9 µmol, 42%) of the title compound is isolated as a colorless oil. Example EL9 (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-pentyl]-carbamicacid-7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 56 mg (65.9 µmol) of the compound that is prepared according to Example EL7b is reacted analogously to Example ELI, and after purification, 24.7 mg (33.6 µmol, 51%) of the title compound is isolated as a colorless foam. 1H-NMR (CDCl3): δ = 0.97-1.84 a m), 1.02 (3H), 1.07 (3H), 1.20 (3H), 1.71 (3H), 1.91 (1H), 2.27-2.57 (6H), 2.84 (3H). 2.88 (1H), 2.95 (1H), 3.16 (2H), 3.51 (3H), 4.02 (1H), 4.46+4.83 (1H), 4.94-5.03 (2H). 5.15 (1H), 5.20 (1H), 5.74 (1H), 5.84 (1H), 6.68 (2H), 7.35 (1H), 7.80 (1H), 7.96 (1H) ppm. Example EL 10 (lS,3S,7S,10R,HS,12S,16R)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-pentyl]-carbamic acid-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-l 1-yl ester (A) and (lS,3S,7S,10R,llS,12S,16R)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-pentyl]-carbamic acid-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3 -(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]hepta-dec-l 1-yl ester (B) 24.7 rng (33.6 µmol) of the compound that is prepared according to Example EL9 is reacted analogously to Example EL2, and after purification, 16.7 mg (22.2 µmol, 66%) of title compound A as well as 2.0 mg (2.7 µmol, 8%) of title compound B are isolated in each case as a colorless foam. 1H-NMR(CDCl3) of A: δ = 0.98 (3H), 1.04 (3H), 1.10-1.75 (13H), 1.23 (3H), 1.26 (3H), 2.09-2.62 (6H), 2.75 (1H), 2.84 (3H), 3.15 (2H), 3.51 (2H), 3.57 (1H), 3.99 (1H), 4.08 (1H), 4.46+4.74 (1H), 4.93-5.02 (2H), 5.18 (1H), 5.76 (1H), 6.18 (1H), 6.68 (2H), 7.38 (1H), 7.82 (1H), 7.97 (1H) ppm. 1H-NMR (CDC13) of B: δ = 0.83-1.85 (13H), 0.95 (3H), 1.01 (3H), 1.27 (3H), 1.32 (3H), 2.17-2.49 (6H), 2.84 (3H), 3.03 (1H), 3.17 (2H), 3.48 (1H), 3.53 (2H), 3.86 (1H), 4.18 (1H), 4.66 (1H), 4.94-5.03 (2H), 5.27 (1H), 5.76 (1H), 6.33 (1H), 6.69 (2H), 7.35 (1H), 7.81 (1H), 7.96 (IH)ppm. Example ELI 1 (1 S,3S(E),7S, 1 OR,11 S,12S,16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-l -yl)-propyl]-carbamic acid 7-[3-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-propylcarbamoyloxy]-8,8,10,12,16-pentamethyl-3-[l-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-l 1-yl ester 10 mg (19.7 µmol) of (1S,3S(E),7S,10R,11S,12S,16R)-7,11-dihydroxy-8,8,10,12,16-pentamethyl-3-[l-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadecane is reacted analogously to Example ELlb with the linker that is produced according to Example L4a, and after purification, 7 mg (8.06 µmol, 41%) of the title compound is isolated as a colorless oil. 1H-NMR (CDC13): δ = 0.88-2.20 (13H). 1.03 (3H), 1.05 (3H), 1.10 (3H), 1.24 (3H), 1.28 (3H), 2.08 (3H), 2.63-2.85 (4H), 2.71 (3H), 2.99-3.25 (3H), 3.41-3.50 (3H), 3.62 (2H), 4.88-5.70 (5H), 6.52 (1H), 6.69 (2H), 6.71 (2H), 7.02 (1H) ppm. Example EL 12 (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-1 -yl)-phenyl ester Example EL12a (4SJR,8S,9S,13Z,16S)-Chloroforrnicacid-7-allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester The solution ofl.0g(1.56 mmol) of the compound, prepared according to Example ELI a, in 20 ml of dichlororhethane is mixed at 0°C with the solution of 285 mg of triphosgene in 6 ml of dichloromethane, 160 µl of pyridine, and it is stirred for 2.5 hours at 23°C. It is concentrated by evaporation, the residue is dissolved in ethyl acetate, washed with water and saturated sodium chloride solution, and dried over magnesium sulfate. The residue that is obtained after filtration and removal of the solvent is purified by chromatography on fine silica gel. 1.08 g (1.53 mmol, 98%) of the title compound is isolated. Example EL 12b (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-8-(tert-butyl-dimethyl-silanyloxy)- 5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13- en-4-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-phenyl ester The solution of 267 mg (370 µmol) of the compound, prepared according to Example EL12a, in 16 ml of ethyl acetate, is mixed with 51 µl of triethylamine, 700 mg of the compound that is prepared according to Example L8, and it is stirred for 16 hours at 23 °C. It is poured into water, extracted several times with ethyl acetate, the combined organic extracts are washed with saturated sodium chloride solution and dried over magnesium sulfate. The residue that is obtained after filtration and removal of the solvent is purified by chromatography on fine silica gel. 188 mg (219 µmol, 59%) of the title compound is isolated. Example EL 12 (4S,7R,8S,9S,13Z,16S)-Carbonicacid 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-l -yl)-phenyl ester Analogously to Example ELI, 248 mg (289 µmol) of the compound that is prepared according to Example EL12a is reacted, and after working-up and purification, 149 mg (201 µmol, 69%) of the title compound is isolated. 1H-NMR (CDC13): δ = 1.08 (3H), 1.14 (3H), 1.26 (3H), 1.04-1.90 (8H), 2.24-2.57 (6H), 2.68-2.99 (3H), 2.81 (3H), 3.45 (1H), 3.72 (1H), 5.02 (1H), 5.06 (1H), 5.17 (1H), 5.65 (1H), 5.74 (1H), 5.98 (1H), 6.79 (2H), 6.88 (2H), 7.21 (2H), 7.33 (1H), 7.64 (1H), 7.97 (1H) ppm. Example EL 13 (1S,3S,7S,10R,1 lS,12S,16R)-Carbonic acid-10-allyl-l l-hydroxy-8,8,12,16- tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclo[14.1.0]heptadec-7-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-phenyl ester Analogously to Example EL2, 144 mg (194 µmol) of the compound that is prepared according to Example EL 12 is reacted, and after working-up and purification, 89 mg (117 µmol, 60%) of the title compound is isolated. 1H-NMR(CDC13):δ=1.10(3H), 1.14(3H), 1.27(3H), 1.32(3H), 1.19-1.85 (7H), 2.08-2.89 (8H), 2.81 (3H), 3.50 (1H), 3.70 (1H), 5.02 (1H), 5.07 (1H), 5.58 (1H), 5.72 (1H), 6.10 (1H), 6.81 (2H), 6.88 (2H), 7.21 (2H), 7.31 (1H), 7.68 (1H), 7.93 (1H) ppm. Example EL 14 (4S,7R,8S,9S,13Z,16S)-Carbonicacid 7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-phenyl ester Example EL14a (4S,7R,8S,9S, 13Z, 16S)-Chloroformic acid-7-allyl-4-(re7-r-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester Analogously to Example EL12a, 1.0 g (1.56 mmol) of the compound that is prepared according to Example EL7a is reacted, and 1.05 g (1.49 mmol, 96%) of the title compound is isolated. Example EL14b (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-ally]-4-(tert-butyl-dimethyl-silanyloxy)- 5,5,9,13-tetramethyl-16-(2-meihyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13- en-8-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-phenyl ester The solution of 313 mg (0.44 mmol) of the compound, prepared according to Example EL14a, in 19 ml of ethyl acetate is mixed with 840 mg of the compound that is prepared according to Example L8, 61.5 µl of triethylamine, and it is stirred for 16 hours at 23 °C. It is mixed with water, extracted several times with ethyl acetate, the combined organic extracts are washed with saturated sodium chloride solution and dried over sodium sulfate. The residue that is obtained after filtration and removal of the solvent is purified by chromatography on fine silica gel. 298 mg (348 µmol, 79%) of the title compound is isolated. Example EL 14 (4S,7R,8S,9S,13Z,16S)-Carbonicacid7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-l -yl)-phenyl ester Analogously to Example ELI, 304 mg (355 µmol) of the compound that is prepared according to Example EL14a is reacted, and after working-up and purification, 67 mg (90 µmol, 25%) of the title compound is isolated. 1H-NMR (CDCl3): δ = 1.09 (3H), 1.11 (3H), 0.84-2.02 OTH), 1.27 (3H), 1.72 (3H), 2.29-2.58 (6H), 2.84 (3H), 2.89 (1H), 2.96 (1H). 3.63 (1H). 4.03 (1H), 5.06 (2H), 5.23 (2H), 5.80 (1H), 5.85 (1H), 6.86 (2H), 7.30 (2H), 7.35 (1H), 7.39 (1H), 7.80 (1H), 7.96(lH)ppm. Example EL 15 (1 S,3S,7S, 1 OR, 11S, 12S, 16R)-Carbonic acid-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-ll-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-phenyl ester Analogously to Example EL2, 67 mg (90 µmol) of the compound that is prepared according to Example EL 14 is reacted, and after working-up and purification, 32 mg (42 µmol, 47%) of the title compound is isolated. 1H-NMR (CDC13): δ= 1.05 (3H), 1.06 (3H), 1.25 (3H), 1.35 (3H), 1.21-1.90 (7H), 2.18 (2H), 2.33-2.67 (4H), 2.73 (1H), 2.85 (3H), 3.79 (1H), 4.11 (1H), 4.33 (1H), 5.02 (1H), 5.07 (1H), 5.31 (1H), 5.81 (1H), 6.27 (1H), 6.86 (2H), 7.29 (2H), 7.35-7.41 (3H), 7.83 (1H), 7.99 (1H) ppm. Example EL 16 (lS,3S(E),7S,10R,HS,12S,16R)-N-[l-({4-[2-(7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-3-yl)-propenyl]-thiazol-2-ylmetiiyl}-carbarnoyl)-ethyl]-3-rnethyltrisulfanyl-N-rnethyl-propionarnide The solution of 7 mg (13 µmol) of (lS,3S(E),7S,10R,HS,12S,16R)-3-[2-(2-aminomethyl-thiazol-4-yl)-1 -methyl-vinyl]-7,11 -dihydroxy-8,8,10,12,16-penta-methyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione, which was produced analogously to the process described in WO 99/01124, in 0.5 ml of dichloromethane is mixed with 7 mg of the compound that is prepared according to Example LI, 0.4 mg of 4-dimethylatninopyridine and 4 mg of N,N'-dicyclohexylcarbodiimide are added, and it is stirred for 20 minutes at 23 °C. Precipitated urea is filtered out, and it is purified by chromatography on a preparative thin-layer plate. 5 mg (6.5 µmol, 50%) of the title compound is isolated. 1H-NMR (CDC13): δ = 1.00 (3H), 1.08 (3H), 1.17 (3H). 1.23-1.77 (5H), 1.28 (3H), 1.36 (3H), 1.39 (3H), 1.88-2.13 (3H), 2.10 (3H), 2.37 (1H). 2.49-2.66 (2H), 2.55 (3H), 2.77-2.92 (4H), 2.97 (3H), 3.16 (2H), 3.31 (1H), 3.77 (1H), 4.08 (1H), 4.19 (1H), 4.62 (1H), 4.76 (1H), 5.25 (1H), 5.45 (1H), 6.57 (1H), 7.01 (1H). 7.06 (1H) ppm. Example EL 17 (1 S,3S(E),7S, 1 OR, 11 S, 12S. 16R)-2-[Methyl-(3-methyltrisulfanyl-propionyl)-amino]-propionic acid-4-[2-(7,l 1 -dihydroxy-8,8,10,12.16-pentamethyl-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-3-yl)-propenyl]-thiazol-2-yknethyl ester Analogously to Example ELI6, 10mg(19 µmol) of (1S,3S(E),7S,10R,11S, 12S, 16R)-7,11 -dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -methyl-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0] heptadecane-5,9-dione, which was produced analogously to the process that is described in WO 99/01124, is reacted, and 2.2 mg (2.8 µmol, 15%) of the title compound is isolated. 1H-NMR (CDCl3): δ -1.01 (3H), 1.09 OH), i.is (3E\ 1.27 (m), 1.28 (3H), 1.32-1.76 (3H), 1.37 (3H), 1.47 (3H), 1.95 (1H), 2.06 (1H), 2.12 (3H), 2.38 (1H), 2.51-2.63 (2H), 2.56 (3H), 2.78-2.92 (5H), 2.97+3.01 (3H), 3.13-3.35 (3H), 3.71 (1H), 3.77 (1H), 4.00 (1H), 4.18 (1H), 5.25 (1H), 5.39 (2H), 5.45 (1H), 6.60 (1H), 7.17 (1H) ppm. Example EL 18 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Example EL18a 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-8-(terr-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-l 6-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2- nitro-phenyl ester Analogously to Example EL12b, 200 mg (284 jamol) of the compound that is prepared according to Example EL12a is reacted with 770 mg of the compound that is prepared according to Example L9, and after working-up and purification, 129 mg (129 µmol, 45%) of the title compound is isolated. Example EL 18 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl] -2 -nitro-phenyl ester Analogously to Example ELI, 129 mg (129 µmol) of the compound that is prepared according to Example EL18a is reacted, and after working-up and purification, 71 mg (80 uxnol, 62%) of the title compound is isolated. .C 6. Z-&5-" 1H-NMR (CDC13): δ = 0.88-2.11 (11H), 1.02 (3H), 1.14(3H), 1.71 (3H), 2.23-2.56 (6H), 2.63-2.71 (3H), 2.74 (3H), 2.97 (1H), 3.39 (1H), 3.68 (3H), 4.58 (1H), 4.78 (1H), 5.01 (1H), 5.05 (1H), 5.18 (1H), 5.56 (IH), 5.71 (1H), 5.97 (IH), 6.73 (2H), 7,19 (1H), 7.31 (IH), 7.36 (IH), 7.75 (IK), 7.77 (IH), 7.95 (IH) ppm. Example EL 19 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lS,3S,7S,10R,l 1S,12S,16R)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[l4.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (A) and 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lR,3S,7S,10R,HS,12S,16S)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,l 7-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (B) Analogously to Example EL2, 71 mg (80 µmol) of the compound that is prepared according to Example ELI 8 is reacted, and after working-up -and purification, 41 mg (45 µmol, 57%) of title compound A as well as 12 mg (13 µmol, 17%) of title compound B are isolated. 1H-NMR (CDC13) of A: δ = 1.04 (3H), 1.14 (3H), 1.16 (3H), 1.32 (3H), 1.34-1.84 (6H), 2.01-2.74 (12H), 2.78 (3H), 2.86 (IH), 3.44 (IH), 3.68 (3H), 4.56 (IH), 4.74 (IH), 5.01 (IH), 5.06 (IH), 5.47 (IH), 5.70 (IH), 6.07 (IH), 6.73 (2H), 7.20 (IH), 7.32 (IH), 7.36 (IH), 7.77 (IH), 7.81 (IH), 7.90 (IH) ppm. Example EL20 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl] -2 -nitro-phenyl ester Example EL20a 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9.13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example EL12b, 243 mg (345 µmol) of the compound that is prepared according to Example EL12a is reacted with 1 g of the compound that is prepared according to Example L10, and after working-up and purification, 25 mg (24 µmol, 7%) of the title compound is isolated. Example EL20 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyi-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELI, 212 mg (206 µmol) of the compound that is prepared according to Example EL20a is reacted, and after working-up and purification, 117 mg (128 µmol, 62%) of the title compound is isolated. 1H-NMR(CDCl3): δ = 1.01 (3H), 1.14 (6H), 1.04-2.78 (20H), 1.70 (3H), 2.74 (3H), 2.97 (1H), 3.39 (1H), 3.56 (2H), 3.68 (1H), 4.11 (1H), 4.58 (1H), 4.77 (1H), 5.00 (1H), 5.05 (1H), 5.18 (1H), 5.56 (1H), 5.71 (1H), 5.97 (1H), 6.69 (2H), 7.12 (1H), 7.29 (1H), 7.36 (1H), 7.75 (2H), 7.94 (1H) ppm. Example EL21 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(lS,3S,7S,10R,l 1S,12S,16R)-[10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[l4.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (A) and 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(lR,3S,7S,10R,HS,12S,16S)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (B) Analogously to Example EL2,117 mg (128 µmol) of the compound that is prepared according to Example EL20 is reacted, and after working-up -and purification, 63 mg (68 µmol, 53%) of title compound A as well as 19 mg (20 µmol, 16%) of title compound B are isolated. 1H-NMR(CDCl3) of A: δ= 1.03 (3H), 1.14 (3H), 1.15 (3H), 1.32 (3H), 1.07-2.75 (22H), 2.77 (3H), 2.86 (1H), 3.44 (1H), 3.55 (2H), 3.69 (1H), 4.55 (1H), 4.77 (1H), 5.01 (1H), 5.06 (1H), 5.47 (1H), 5.70 (1H), 6.08 (1H), 6.70 (2H), 7.14 (1H), 7.31 (1H), 7.35 (1H), 7.76 (1H), 7.80 (1H), 7.90 (1H) ppm. Example EL22 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Example EL22a 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-(fert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2- nitro-phenyl ester Analogously to Example EL12b, 243 mg (345 µmol) of the compound that is prepared according to Example EL12a is reacted with 1.19 g of the compound that is prepared according to Example LI 1, and after working-up and purification, 171 mg (155 µmol, 45%) of the title compound is isolated. Example EL22 1 l-(2,5-Dioxo-2,5-dmydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-hydroxy-5,5,943-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELI, 171 mg (155 µmol) of the compound that is prepared according to Example EL22a is reacted, and after working-up and purification, 108 mg (110 µmol, 71%) of the title compound is isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.14 (6H), 0.88-2.56 (28H), 1.70 (3H), 2.63 (2H), 2.71 (1H), 2.74 (3H), 2.98 (1H), 3.39 (1H), 3.50 (2H), 3.69 (1H), 4.58 (1H), 4.77 (1H), 5.00 (1H), 5.05 (1H), 5.17 (1H), 5.56 (1H), 5.71 (1H), 5.97 (1H), 6.68 (2H), 7.11 (1H), 7.29 (1H), 7.36 (1H), 7.75 (1H), 7.76 (1H), 7.94 (1H) ppm. Example EL23 ll-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(lS,3S,7S,10R,HS,12S,16R)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (A) and 1 l-(2,5-Dioxo-2,5-dihydro- pyrrol-l-yl)-undecanoic acid 4-(lR,3S,7S,10R,l ] S,12S, 16S)-[10-allyl-l 1-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazolo-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (B) Analogously to Example EL2, 108 mg (110 (amol) of the compound that is prepared according to Example EL22 is reacted, and after working-up and purification, 65.9 mg (65.8 µmol, 60%) of title compound A as well as 19.8 mg (20 µmol, 18%) of title compound B are isolated. 1H-NMR(CDCl3) of A: δ = 1.04 (3H), 1.14 (3H), 1.15 (3H), 1.63 (3H), 0.92-1.85 (23H), 2.10-2.81 (9H), 2.77 (3H), 2.86 (1H), 3.45 (1H), 3.51 (2H), 3.69 (1H), 4.55 (1H), 4.74 (1H), 5.01 (1H), 5.06 (1H), 5.47 (1H), 5.70 (1H), 6.08 (1H), 6.68 (2H), 7.13 (1H), 7.31 (1H), 7.35 (1H), 7.77 (1H), 7.80 (1H), 7.90 (1H) ppm. Example EL24 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Example EL24a 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,l6S)-[7- allyl-4-(tert-butyl-cu'methyl-silanyloxy)-5,5,9.13 -tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2- nitro-phenyl ester Analogously to Example EL12b, 271 mg (385 µmol) of the compound that is prepared according to Example EL14a is reacted with 1.04 g of the compound that is prepared according to Example L9, and after working-up and purification, 193 mg (193 nmol, 50%) of the title compound is isolated. Example EL24 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl -benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELI, 193 mg (193 µmol) of the compound that is prepared according to Example EL24a is reacted, and after working-up and purification, 107 mg (120 µmol, 62%) of the title compound is isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.07 (3H), 1.23 (3H), 0.97-2.13 (8H), 1.71 (3H), 2.28-2.54 (6H), 2.67 (2H), 2.84 (3H), 2.88 (1H), 2.95 (1H), 3.56 (1H), 3.67 (2H), 4.01 (1H), 4.93 (1H), 4.98 (1H), 5.17 (1H), 5.22 (3H), 5.70 (1H), 5.84 (1H), 6.72 (2H), 7.30 (1H), 7.34 (1H), 7.69 (1H), 7.80 (1H), 7.95 (1H), 8.13 (1H) ppm. Example EL25 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lS,3S,7S,10R,l 1S,12S,16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[l4.1.0]heptadec-l 1 -yloxycarbonyloxymethyl]-2-nitro-phenyl ester (A) and 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lR,3S,7S,10R,HS,12S,16S)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-11 -yloxycarbonyloxymethyl]-2-nitro-phenyl ester (B) Analogously to Example EL2, 102 mg (135 .µmol) of the compound that is prepared according to Example EL 19 is reacted, and after .working-up and purification, 65 mg (72 µmol, 63%) of title compound A as well as 3 mg (3.3 µmol, 3%) of title compound B are isolated. 1H-NMR (CDC13) of A: δ= 0.97 (3H), 1.04 (3H), 1.23 (3H), 1.31 (3H), 1.10-2.75 (18H), 2.85 (3H), 3.68 (2H), 3.71 (1H), 4.09 (1H), 4.28 (1H), 4.92 (1H), 4.97 (1H), 5.20 (2H), 5.23 (1H), 5.72 (1H), 6.26 (1H), 6.72 (2H), 7.30 (1H), 7.37 (1H), 7.68 (1H), 7.83 (1H), 7.98 (1H), 8.13 (lH)ppm. Example EL26 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoicacid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Example EL26a 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example EL12b, 273 mg (387 µmol) of the compound that is prepared according to Example EL14a is reacted with 1.12 g of the compound that is prepared according to Example L10, and after working-up and purification, 69 mg (67 µmol, 17%) of the title compound is isolated. Example EL26 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoicacid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-niethyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELI, 69 mg (67 µmol) of the compound that is prepared according to Example EL26a is reacted, and after working-up and purification, 26 mg (28 µmol, 42%) of the title compound is isolated. 1H-NMR (CDC13): δ = 0.93 (3H), 0.95 (3H), 1.16 (3H), 1.60 (3H), 0.98-2.61 (20H), 2.73 (3H), 2.77 (1H), 3.45 (3H), 3.83 (1H), 4.05 (1H), 4.83 (1H), 4.88 (1H), 5.05 (1H), 5.13 (3H), 5.62 (1H), 5.74 (1H), 6.61 (2H),"7.16 (1H), 7.26 (1H), 7.60 (1H), 7.70 (1H), 7.88 (1H), 8.03 (1H) ppm. Example EL27 6-(2,5-Dioxo-2,5-diliydro-pyrrol-l-yl)-hexanoic acid 4-(lS,3S,7S,10R,l 1S,12S,16R)- [10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo- 4,17-dioxa-bicyclo[14.1.0]heptadec-ll-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (A) and 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4- (1R,3S,7S, 1 OR,11 S,12S, 16S)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[ 14.1 .0]heptadec-11 - yloxycarbonyloxymethyl]-2-nitro-phenyl ester (B) Analogously to Example EL2, 38 mg (41 µmol) of the compound that is prepared according to Example EL 19 is reacted, and after working-up and purification, 14 mg (15 µmol, 37%) of title compound A as well as 2 mg (2 µmol, 5%) of title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.96 (3H), 1.03 (3H), 1.08-1.86 (13H), 1.23 (3H), 1.30 (3H), 2.16 (2H), 2.23-2.78 (7H), 2.83 (3H), 3.54 (2H), 3.71 (1H), 4.09 (1H), 4.27 (1H), 4.91 (1H), 4.96 (1H), 5.21 (3H), 5.72 (1H), 6.25 (1H), 6.69 (2H), 7.23 (1H), 7.36 (1H), 7.67 (1H), 7.82 (1H), 7.96 (1H), 8.11 (1H) ppm. Example EL28 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4Sr7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Example EL28a 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4SJR,8S,9S,13Z,16S)-[7- allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-l 6-(2-methyl- ben2;othiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2- nitro-phenyl ester Analogously to Example EL12b, 273 mg (387 µmol) of the compound that is prepared according to Example EL14a is reacted with 1.34 g of the compound that is prepared according to Example LI 1, and after working-up and purification, 196 mg (178 µmol, 46%) of the title compound is isolated. Example EL28 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELI, 196 mg (178 µmol) of the compound that is prepared according to Example EL28a is reacted, and after working-up and purification, 100 mg (101 µmol, 57%) of the title compound is isolated. 1H-NMR(CDCl3): δ= 1.03 (3H), 1.06 (3H), 1.23 (3H), 1.70 (3H), 0.99-1.81 (21H), 1.91 (1H), 2.27-2.53 (6H), 2.63 (2H), 2.83 (3H), 2.88 (1H), 2.95 (1H), 3.51 (2H), 3.56 (1H), 4.00 (1H), 4.92 (1H), 4.98 (1H), 5.13-5.26 (4H); 5.71 (1H), 5.83 (1H), 6.68 (2H), 7.23 (1H), 7.34 (1H), 7.67 (1H), 7.79 (1H). 7.95 (1H), 8.13 (1H) ppm. Example EL29 ll-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4- (lS,3S,7S,10R,HS,12S,16R)-[10-allyl-7-hydroxy-8.8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,l 7-dioxa-bicyclo[ 14.1.0]heptadec-l 1 -yloxycarbonyloxymethyl]-2-nitro-phenyl ester (A) and ll-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(lR,3S,7S,10R.l IS, 12S,16S)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-y])-5,9-dioxo-4.17-dioxa-bicyclo[14.1.0]heptadec-11 -yloxycarbonyloxymethyl]-2-nitro-phenyl ester (B) Analogously to Example EL2,100 mg (101 µmol) of the compound that is prepared according to Example EL 19 is reacted, and after working-up and purification, 21 mg (21 µmol, 21%) of title compound A as well as 2 mg (2 µmol, 2%) of title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.97 (3H), 1.04 (3H), 1.23 (3H), 0.84-1.84 (24H), 1.71 (3H), 2.15 (2H), 2.23-2.68 (5H), 2.71 (1H), 2.83 (3H), 3.50 (2H), 3.71 (1H), 4.09 (1H), 4.27 (1H), 4.91 (1H), 4.96 (1H), 5.19 (2H), 5.23 (1H), 5.72 (1H), 6.26 (1H), 6.68 (2H), 7.23 (1H), 7.36 (1H), 7.66 (1H), 7.83 (1H), 7.97 (1H), 8.12 (IH)ppm. Example EL30 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-phenyl ester Example EL30a 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]- phenyl ester Analogously to Example EL12b, 218 mg (309 µmol) of the compound prepared according to Example EL12a are reacted with 314 mg of the compound prepared according to Example LI2. After working-up and purification, 103 mg (118 µmol, 35%) of the title compound are isolated. Example EL30 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl] -phenyl ester Analogously to Example ELI, 103 mg (118 µmol) of the compound prepared according to Example EL30a are reacted. After working-up and purification, 13 mg (15 (imol, 13%) of the title compound are isolated. 1H-NMR (CDC13): δ= 0.88-1.84 (7H), 1.00 (3H), 1.12 (3H), 1.14 (3H), 1.71 (3H), 2.04 (2H), 2.23-2.71 (8H), 2.74 (3H), 2.99 (1H), 3.40 (1H), 3.67 (3H), 4.48 (1H), 4.76 (1H), 5.00 (1H), 5.04 (1H), 5.18 (1H), 5.55 (1H), 5.71 (1H), 5.98 (1H). 6.72 (2H), 7.01 (2H), 7.08 (2H), 7.37 (1H), 7.76 (1H), 7.96 (1H) ppm. Example EL31 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lS,3S,7S,10R,llS,12S, 16R)- [ 10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo- 4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example EL2, 13 mg (15 µmol) of the compound prepared according to Example EL30 are reacted. After working-up and purification, 5.7 mg (6.6 µmol, 44%) of the title compound are isolated. 1H-NMR (CDC13) of A: δ = 1.04 (3H), 1.14 (3H), 1.16 (3H), 1.32 (3H), 1.34-1.84 (6H), 2.04 (2H), 2.15-2.75 (10H), 2.78 (3H), 2.85 (1H), 3.44 (1H), 3.67 (3H), 4.48 (1H), 4.73 (1H), 5.01 (1H), 5.05 (1H), 5.47 (1H), 5.70 (1H), 6.07 (1H), 6.72 (2H), 7.02 (2H), 7.13 (2H), 7.31 (1H), 7.77 (1H), 7.93 (1H) ppm. Example EL32 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl] -phenyl ester Example EL32a 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13ZJ6S)-[7-allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example EL12b, 218 mg (309 uznol) of the compound prepared according to Example EL12a are reacted with 396 mg of the compound prepared according to Example LI3. After working-up and purification, 157 mg (159 µmol, 51 %) of the title compound are isolated. Example EL32 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S.9S, 13Z, 16S)-[7- allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-4-yloxycarbonyloxymethylJ -phenyl ester Analogously to Example ELI, 157 mg (159 µmol) of the compound prepared according to Example EL32a are reacted. After working-up and purification, 32 mg (37 µmol, 23%) of the title compound are isolated. 1H-NMR (CDC13): δ = 0.99 (3H), 1.12 (3H). 1.14 (3H), 1.04-2.84 (20H), 1.70 (3H), 2.75 (3H), 3.00 (1H), 3.40 (1H), 3.55 (2H), 3.68 (1H), 4.48 (1H), 4.76 (1H), 5.00 (1H), 5.04 (1H), 5.18 (1H), 5.55 (1H), 5.71 (1H), 5.98 (1H), 6.69 (2H), 6.98 (2H), 7.07 (2H), 7.37 (1H), 7.76 (2H), 7.96 (1H) ppm. Example EL33 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(lS,3S,7S.10R,l 1S,12S, 16R)- [10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3-(2-memyl-benzothiazol-5-yl)-5,9-dioxo- 4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example EL2, 30 mg (34 µmol) of the compound prepared according to Example EL32 are reacted. After working-up and purification, 13 mg (15 µmol, 44%) of the title compound are isolated. 1H-NMR (CDC13) of A: δ = l.Ol (3H), 1.13 (3H), 1.14 (3H), 1.32 (3H), 1.07-2.75 (22H), 2.78 (3H), 2.85 (1H), 3.44 (1H), 3.55 (2H), 3.69 (1H). 4.48 (1H), 4.73 (1H), 5.01 (1H), 5.05 (1H), 5.45 (1H), 5.70 (1H), 6.08 (1H), 6.69 (2H), 6.99 (2H), 7.12 (2H), 7.32 (1H), 7.77 (1H), 7.92 (1H) ppm. Example EL34 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-phenyl ester Example EL34a 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]- phenyl ester Analogously to Example EL12b, 218 mg (309 µmol) of the compound prepared according to Example EL12a are reacted with 422 mg of the compound prepared according to Example LI4. After working-up and purification, 77 mg (73 µmol, 24%) of the title compound are isolated. Example EL34 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example ELI, 77 mg (73 µmol) of the compound prepared according to Example EL34a are reacted. After working-up and purification, 14 mg (15 µmol, 20%) of the title compound are isolated. 1H-NMR (CDC13): δ = 0.99 (3H), l.ll (3H), 1.14 (3H), 0.88-1.88 (22H), 1.70 (3H), 2.24-2.58 (8H), 2.67 (1H), 2.75 (3H), 3.00 (1H), 3.40 (1H), 3.51 (2H), 3.68 (1H), 4.48 (1H), 4.76 (1H), 5.00 (1H), 5.04 (1H), 5.18 (1H), 5.55 (1H), 5.71 (1H), 5.98 (1H), 6.68 (2H), 6.98 (2H), 7.07 (2H), 7.37 (1H), 7.76 (1H), 7.96 (1H) ppm. Example EL35 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-( 1 S,3S,7S,10R,11S,12S, 16R)-[ 10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9- dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example EL2, 14 mg (15 µmol) of the compound prepared according to Example EL34 are reacted. After working-up and purification. 6 mg ( 6 µmol, 42%) of the title compound are isolated. 1H-NMR (CDC13) von A: δ = l.Ol (3H), 1.14 (6H), 1.20-1.90 (26H), 2.12-2.58 (8H), 2.71 (1H), 2.77 (3H), 2.85 (1H), 3.44 (1H), 3.51 (2H), 3.69 (1H), 4.48 (1H), 4.73 (1H), 5.01 (1H), 5.05 (1H), 5.45 (1H), 5.70 (1H), 6.08 (1H), 6.68 (2H), 6.99 (2H), 7.12 (2H), 7.31 (1H), 7.77 (1H), 7.92 (1H) ppm. Example EL36 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13 -en- 8 -yloxycarbonyloxymethyl] -phenyl ester Example EL36a 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example EL12b, 330 mg (470 µmol) of the compound prepared according to Example EL14a are reacted with 544 mg of the compound prepared according to Example L12. After working-up and purification, 170 mg (178 f-imol, 38%) of the title compound are isolated. Example EL36 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9SJ3Z,16S)-[7- allyl-4-hydroxy-5,5,9,13-tetramethyI-16-(2 -methyl -benzothiazol-5-yI)-2,6-dioxo- oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example ELI, 170 mg (178 µmol) of the compound prepared according to Example EL36a are reacted. After working-up and purification, 21 mg (24 µmol, 14%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.07 (3H). 1.22 (3H), 0.97-2.13 (8H), 1.70 (3H), 2.28-2.63 (8H), 2.84 (3H), 2.82-2.95 (2H), 3.55 (1H), 3.67 (2H), 3.97 (1H), 4.92 (1H), 4.96 (1H), 5.15 (1H), 5.16 (2H), 5.22 (1H), 5.70 (1H), 5.82 (1H), 6.68 (2H), 7.08 (2H), 7.34 (1H), 7.41 (2H), 7.79 (1H), 7.94 (1H) ppm. Example EL3 7 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lS,3S,7S,10R,llS,12S, 16R)- [10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo- 4,17-dioxa-bicyclo[14.1.0]heptadec-ll-yloxycarbonyloxymethyl]-2-nitro-phenyl ester (A) and 4-(2,5-Dioxo-2,5-dmydro-pyrrol-l-yl)-butanoic acid 4-(lR,3S,7S,10R,l 1S,12S,16S> [ 10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-l l-yloxycarbonyloxymethyl]-phenyl ester (B) 32 mg (38(imol) of the compound prepared according to Example EL36 are reacted. After working-up and purification, 10.1 mg ( 12 µmol, 31%) of title compound A as well as 1.2 mg (1.4 u.mol, 3,7%) of title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.96 (3H), 1.04 (3H), 1.24 (3H), 1.29 (3H), 0.90-1.78 (7H), 2.04 (2H), 2.16 (2H), 2.20-2.62 (6H), 2.72 (1H), 2.84 (3H), 3.67 (2H), 3.69 (1H), 4.07 (1H), 4.20 (1H), 4.91 (1H), 4.95 (1H), 5.14 (2H), 5.22 (1H), 5.72 (1H), 6.24 (1H), 6.71 (2H), 7.10 (2H), 7.37 (1H), 7.40 (2H), 7.88 (1H), 7.97 (1H) ppm. Example ELS 8 6-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-hexanoic acid 4-(4S, 7R,8S,9S, 13Z, 16S )-[7- allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl] -phenyl ester Example EL38a 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,l 6S)-[7- allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]- phenyl ester Analogously to Example EL12b, 450 mg (640 u.mol) of the compound prepared according to Example EL14a are reacted with 811 mg of the compound prepared according to Example LI3. After working-up and purification, 108 mg (110 u.mol, 17%) of the title compound are isolated. Example EL38 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-phenyl ester 108mg (110 µmol) of the compound prepared according to Example EL38a in 22 ml dichloromethane are mixed with 1.06 mJ (2.74 mmol) of a 20% solution of trifluoroacetic acid in dichloromethane. After 16 hours the mixture is diluted with dichloromethane and poured into a saturated solution of sodium bicarbonate. The mixture is extracted several times with dichloromethane and the combined organic extracts are dried over sodium sulfate. The residue obtained by filtration and removal of the solvent is purified by chromatography on fine silica gel. 64 mg (73 u.mmol, 67%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.07 (3H), 1.16 (3H), 1.70 (3H), 0.98-1.96 (12H), 2.25-2.58 (8H), 2.83 (3H), 2.90 (2H), 3.55 (3H), 3.97 (1H), 4.92 (1H), 4.96 (1H), 5.15 (1H), 5.16 (2H), 5.22 (1H), 5.70 (1H), 5.82 (1H), 6.69 (2H), 7.08 (2H), 7.34 (1H), 7.41 (2H), 7.79 (1H), 7.94 (1H) ppm. Example EL39 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(lS,3S,7S,10R,llS,12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.I.O]heptadec-l l-yloxycarbonyloxyrnethyl]-phenyl ester (A) und 6-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-hexanoic acid 4-(l R,3S,7S, 1 OR, 11S, 12S, 16S)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-l l-yloxycarbonyloxymethyl]-phenyl ester (B) Analogously to Example EL2, 64 mg (73 µmol) of the compound prepared according to Example EL38 are reacted. After working-up and purification, 25 mg (28 µmol, 39%) of the title compound A as well as 5.4 mg (6.1 µmol, 8.3%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.96 (3H), 1.04 (3H), 1.13-1.82 (13H), 1.23 (3H), 1.29 (3H), 2.15 (2H), 2.22-2.64 (6H), 2.71 (1H), 2.84 (3H), 3.54 (2H), 3.69 (1H), 4.08 (1H), 4.20 (1H), 4.91 (1H), 4.95 (1H), 5.14 (2H), 5.22 (1H), 5.72 (1H), 6.24 (1H), 6.69 (2H), 7.07 (2H), 7.37 (1H), 7.40 (2H), 7.82 (1H), 7.97 (1H) ppm. Example EL40 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-iindecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-4-hydroxy-5,5,9,13-terramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-8-yloxycarbonyloxymethyI]-phenyl ester Example EL40a 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9.13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]- phenyl ester Analogously to Example EL12b, 450 mg (640 µmol) of the compound prepared according to Example EL14a are reacted with 992 mg of the compound prepared according to Example LI4. After working-up and purification, 67 mg (63 µmol, 10%) of the title compound are isolated. Example EL40 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-4-hydroxy-5,5,9,13-tetramethyl-l 6-(2-memyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en- 8-yloxycarbonyloxymethyl]-phenyl ester Analogously to Example EL38, 67 mg (63 µmol) of the compound prepared according to Example EL40a are reacted. After working-up and purification, 23 mg (24 µmol, 38%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.07 (3H), 1.21 (3H), 1.70 (3H), 0.99-1.81 (21H), 1.91 (1H), 2.27-2.58 (8H), 2.83 (3H), 2.89 (2H), 3.50 (2H), 3.55 (1H), 3.97 (1H), 4.92 (1H), 4.96 (1H), 5.15 (1H), 5.16 (2H), 5.20 (1H), 5.70 (1H), 5.82 (1H), 6.68 (2H), 7.08 (2H), 7.34 (1H), 7.41 (2H), 7.79 (1H), 7.94 (1H) ppm. Example EL41 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(lS,3S,7S,10R,l 1S,12S, 16R)-[10-allyl-7-hydroxy-8,842,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9- dioxo-4,17-dioxa-bicyclo[ 14.1 .0]heptadec-11 -yloxycarbonyloxymethyl]-phenyl ester (A) and ll-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4- (lR,3S,7S,10R,llS,12S,16S)-[10-allyl-7-hydroxy-8,8,12,16-terramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,l 7-dioxa-bicyclo[ 14.1 .0]heptadec-11 - yloxycarbonyloxymethyl]-phenyl ester (B) Analogously to Example EL2, 33 mg (35 µmol) of the compound prepared according to Example EL40 are reacted. After working-up and purification, 13 mg (14 µmol. 38%) of the title compound A as well as 4 mg (4 µmol, 12%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.96 OH), 1.04 (3H), 1.23 (3H), 0.91-L78 (27H), 2.16 (2H), 2.23-2.68 (5H), 2.71 (1H), 2.84 (3H), 3.50 (2H). 3.69 (1H), 4.07 (1H), 4.20 (1H). 4.91 (1H), 4.95 (1H), 5.14 (2H). 5.22 (1H), 5.72 (1H). 6.24 (1H), 6.68 (2H), 7.07 (2H), 7.37 (1H), 7.40 (2H), 7.82 (1H), 7.97 (1H) ppm. Example EL42 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-butanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl] -2 -chlor-phenyl ester Example EL42a 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l -yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethylJ-2- chlor-phenyi ester Analogously to Example EL12b. 329 mg (467µmol) of the compound prepared according to Example EL12a are reacted with 885 mg of the compound prepared according to Example LI5. After working-up and purification, 126 mg (127 µmo, 27%) of the title compound are isolated. Example EL42 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l -yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13 -en-4-yloxycarbonyloxymethyl ] -2 -chlor-phenyl ester Analogously to Example ELL 126 mg (127 urnol) of the compound prepared according to Example EL42a are reacted. After working-up and purification, 79 mg (90 µmol, 71%) of the title compound are isolated. 1H-NMR (CDC13): δ - 1.01 (3H), 1.13 (3H), 1.14 (3H), 1.70 (3H), 1.31-1.72 (17hl). 2.75 (3H), 2.99 (1H), 3.40 (1H), 3.68 (3H), 4.49 (1H), 4.70 (1H), 5.00 (1H), 5.05 (1H). 5.18 (1H), 5.55 (1H), 5.71 (1H); 5.98 (1H), 6.72 (2H), 6.99 (1H), 7.07 (1H), 7.10 (1H). 7,36 (1H), 7.75 (1H), 7.95 (1H) ppm. Example EL43 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lS,3S,7S,10R,l 1S,12S, 16R)- [10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5s9-dioxo- 4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-chlor-phenyl ester (A) and 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4- (1R,3S,7S,10R,11S,12S, 16S)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl]-2-chlor-phenyl ester (B) Analogously to Example EL2, 66 mg (75 µmol) of the compound prepared according to Example EL42 are reacted. After working-up and purification, 29.4 mg (32.9µmol, 44%) of the title compound A as well as 9.7 mg (10.9 µmol, 14%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 1.03 (3H), 1.13 (3H), 1.15 (3H), 1.23 (1H), 1.31 (3H), 1.34-2.74 (17H), 2.78 (3H), 2.86 (1H), 3.44 (1H), 3.67 (3H), 4.46 (1H), 4.67 (1H), 5.01 (1H), 5.05 (1H), 5.46 (1H), 5.70 (1H), 6.08 (1H), 6.72 (2H), 7.01 (1H), 7.08 (1H), 7.16 (1H), 7.31 (1H), 7.77 (1H), 7.92 (IH)ppm. Example EL44 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13 -tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Example EL44a 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoicacid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2- chloro-phenyl ester Analogously to Example EL12b, 329 mg (467 µmol) of the compound prepared according to Example EL12a are reacted with 821 mg of the compound prepared according to Example LI6. After working-up and purification, 120 mg (118 µmol, 25%) of the title compound are isolated. Example EL44 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7- allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Analogously to Example ELI, 120 mg (118 µmol) of the compound prepared according to Example EL44a are reacted. After working-up and purification, 60 mg (66 µmol, 56%) of the title compound are isolated. 1H-NMR (CDC13): δ = l.Ol (3H), 1.05 (1H), 1.13 (3H), 1.14 (3H), 1.33-1.89 (12H), 1.71 (3H), 2.24-2.70 (8H), 2.74 (3H), 3.00 (1H), 3.40 (1H), 3.55 (2H), 3.69 (1H), 4.49 (1H), 4.71 (IK), 5.00 (1H), 5.05 (1H), 5.18 (1H), 5.56 (1H), 5.71 (1H), 5.99 (1H), 6.70 (2H), 6.95 (IK), 7.03 (1H), 7.11 (1H), 7.37 (1H), 7.75 (1H), 7.95 (1H), ppm. Example EL45 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(lS,3S,7S,10R,llS,12S, 16R)- [10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3 -(2-methyl-benzothiazol-5-yl)-5,9-dioxo- 4,17-dioxa-bicyclo[l4.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-chloro-phenyl ester (A) and 6-(2,5-Dioxo-2,5-dihydro-pyrrol-1 -yl)-hexanoic acid 4- (1R,3S,7S,10R,11S,12S, 16S)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl]-2-chloro-phenyl ester (B) Analogously to Example EL2, 60 mg (66 µmol) of the compound prepared according to Example EL44 is reacted. After working-up and purification, 32 mg (34.7 µmol, 53%) of the title compound A as well as 11 mg (11.9 µmol, 18%) of the title compound B are isolated. 1H-NMR (CDC13) von A: δ = 1.02 (3H), 1.14 (3H), 1.15 (3H), 1,24 (1H), 1.32 (3H), 1.34-2.74 (21H), 2.77 (3H), 2.86 (1H), 3.44 (1H), 3.55 (2H), 3.69 (1H), 4.46 (1H), 4.67 (1H), 5.01 (1H), 5.05 (1H), 5.46 (1H), 5.70 (1H), 6.09 (IK), 6.69 (2H), 6.99 (1H), 7.04 (1H), 7.16 (1H), 7.32 (IK), 7.77 (IK), 7.92 (1H) ppm. Example EL46 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-chloro-phenyl ester 1 l-(2,5-Dioxo-2,5-dihydro-pyirol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13 -tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2- chloro-phenyl ester Analogously to Example EL12b, 323 mg (459 µmol) of the compound prepared according to Example EL12a are reacted with 790 mg of the compound prepared according to Example LI7. After working-up and purification, 96 mg (88 µmol, 19%) of the title compound are isolated. Example EL46 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-4-yloxycarbonyloxymethyl]-2-chlor-phenyl ester Analogously to Example ELI, 59 mg (54 µmol) of the compound prepared according to Example EL46a are reacted. After working-up and purification, 27 mg (27.7 µmol, 51%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.01 (3H), 1.13 (3H), 1.15 (3H), 1.23-2.70 (31H), 1.71 (3H), 2.74 (3H), 2.99 (1H), 3.40 (1H), 3.51 (2H), 3.68 (1H), 4.49 (1H), 4.70 (1H), 5.00 (1H), 5.04 (1H), 5.18 (1H), 5.56 (1H), 5.71 (1H), 5.99 (1H), 6.68 (2H), 6.95 (1H), 7.03 (1H), 7.11 (1H), 7.36 (1H), 7.75 (1H), 7.95 (1H) ppm. Example EL47 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(lS,3S,7S,10R,l 1S,12S, 16R)-[ 10-allyl-11-hydroxy-8,8,12,16-terramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9- dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-chloro- phenyl ester (A) and ll-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4- (lR,3S,7S,10R,HS,12S,16S)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl]-2-chloro-phenyl ester (B) Analogously to Example EL2, 27 mg (27 µmol) of the compound prepared according to Example EL46 are reacted. After working-up and purification, 14 mg (14.1 µmol. 52%) of the title compound A as well as 5 mg (5.0 µmol, 19%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 1.02 (3H), 1.13 OH): 1.15 (3H), 1.19-1.84 (27HX 2.09-2.74 (8H), 2.77 (3H), 2.85 (1H), 3.44 (1H), 3.50 (2H), 3.69 (1H), 4.46 (1H), 4.67 (1H). 5.01 (1H), 5.06 (1H), 5.45 (1H), 5.70 (1H), 6.08 (1H), 6.68 (2H), 6.99 (1H), 7.04 (1H), 7.16 (1H), 7.31 (1H), 7.76 (1H), 7.91 (1H) ppm. Example EL48 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Example EL48a 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-(tert-butyl-dimethy]-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Analogously to Example EL12b, 340 mg (482 µmol) of the compound prepared according to Example EL14a are reacted with 885 mg of the compound prepared according to Example L15. After working-up and purification, 151 mg (152 µmol, 32%) of the title compound are isolated. Example EL48 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(4S,7R,8S.9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Analogously to Example ELI, 151 mg (152 µmol) of the compound prepared according to Example EL48a are reacted. After working-up and purification, 46 mg (52 µmol, 34%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.07 (3H). 1.26 (3H), 1.71 (3H), 1.15-2.44 (13H), 2.51 (2H), 2.65 (2H), 2.84 (3H), 2.91 (1H), 3.55 (1H), 3.68 (2H), 3.99 (1H), 4.92 (1H), 4.98 (1H), 5.06-5.25 (4H), 5.70 (1H), 5.83 (1H), 6.72 (2H), 7.17 (1H), 7.31 (1H), 7.34 (1H), 7.49 (IE), 7.80 (1H), 7.96 (lH)ppm. Example EL49 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4-(lS,3S,7S,10R,llS,12S, 16R)- [10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo- 4,17-dioxa-bicyclo [14.1.0] heptadec-11 -yloxy carbonyloxymethyl] -2-chloro-phenyl ester (A) and 4-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-butanoic acid 4- (1R,3S,7S, 1 OR,11 S,12S. 16S)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo [ 14.1.0]heptadec-11- yloxycarbonyloxymethyl]-2-chloro-phenyl ester (B) Analogously to Example EL2, 46 mg (52 µmol) of the compound prepared according to Example EL48 are reacted. After working-up and purification, 6 mg (6.7 pinol, 13%) of the title compound A as well as 1 mg (1.1 µmol, 2%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.97 (3H), 1.04 (3H), 1.24 (3H), 1.30 (3H), 1.14-2.76 (21H), 2.85 (3H), 3.68 (3H), 4.09 (1H), 4.23 (1H), 4.91 (1H). 4.97 (1H), 5.11 (2H), 5.22 (1H), 5.72 (1H), 6.25 (1H), 6.72 (2H), 7.16 (1H), 7.30 (1H), 7.37 (1H), 7.48 (1H), 7.83 (1H), 7.99 (IH)ppm. Example EL50 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S, 13Z, 16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Example EL50a 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetrarnethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-8-yloxycarbonyloxymethyi]-2-chloro-phenyl ester Analogously to Example EL12b, 340 mg (482 µmol) of the compound prepared according to Example EL14a are reacted with 848 mg of the compound prepared according to Example L16. After working-up and purification, 158 mg (155 µmol, 32%) of the title compound are isolated. Example EL50 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2.6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Analogously to Example ELI, 158 mg (155 µmol) of the compound prepared according to Example EL50a are reacted. After working-up and purification, 58 mg (64 µmol, 41%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.08 (3H). 1.22 (3H), 1.71 (3H), 0.90-2.45 (17H), 2.51 (2H), 2.61 (2H), 2.83 (3H), 2.88 (1H), 3.55 (3H), 3.97 (1H), 4.92 (1H), 4.98 (1H), 5.10-5.25 (4H), 5.71 (1H), 5.83 (1H), 6.69 (2H), 7.12 (1H), 7.30 (1H), 7.34 (1H), 7.49 (1H), 7.79 (1H), 7.95 (1H) ppm. Example ELS 1 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4-(lS,3S,7S,10R,llS,12S, 16R)- [10-allyl-7-hydroxy-8,8J2,16-tetramethyl-3-(2'-methyl-benzothiazol-5-yl)-5,9-dioxo- 4,17-dioxa-bicyclo[14.1.0]heptadec-l l-yloxycarbonyloxymethyl]-2-chloro-phenyl ester (A) and 6-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoic acid 4- (lR,3S,7S,10R,llS,12S,16S)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-ll- yloxycarbonyloxymethyl]-2-chloro-phenyl ester (B) Analogously to Example EL2, 58 mg (64 µmol) of the compound prepared according to Example EL50 are reacted. After working-up and purification, 25 mg (27 µmol, 42%) of the title compound A as well as 7 mg (7.6 µmol, 12%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.97 (3H), 1.04 OH), 1.24 (3H), 1.31 (3H), 1.12-2.65 (21H), 2.72 (1H), 2.84 (3H), 3.55 (2H), 3.71 (1H), 4.08 (1H), 4.22 (1H), 4.91 (1H), 4.96 (1H), 5.12 (2H), 5.23 (1H), 5.72 (1H), 6.24 (1H), 6.69 (2H), 7.13 (1H), 7.30 (1H), 7.37 (1H), 7.48 (1H), 7.83 (1H), 7.97 (1H) ppm. Example EL52 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Example EL52a 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl- benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13 -en-8-yloxycarbonyloxymethyl]-2- chloro-phenyl ester Analogously to Example EL12b, 355 mg (476 µmol) of the compound prepared according to Example EL14a are reacted with 790 mg of the compound prepared according to Example LI7. After working-up and purification, 122 mg (112 µmol, 24%) of the title compound are isolated. Example EL52 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(4S,7R,8S,9S,13Z,16S)-[7- allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo- oxacyclohexadec-13-en-8-yloxycarbonyloxymethyl]-2-chloro-phenyl ester Analogously to Example ELI, 122 mg (112 µmol) of the compound prepared according to Example EL52a are reacted. After working-up and purification, 28 mg (29 µmol, 26%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.08 (3H), 1.22 (3H), 1.11-2.48 (26H), 1.71 (3H), 2.51 (2H), 2.61 (2H), 2.83 (3H), 2.89 (1H), 3.46-3.58 (3H), 3.98 (1H), 4.61 (2H), 4.92 (1H), 4.98 (1H), 5.11-5.25 (3H), 5.70 (1H), 5.83 (1H), 6.68 (2H), 7.00 (1H), 7.18 (1H), 7.29 (1H), 7.36 (1H), 7.79 (1H), 7.95 (1H) ppm. Example EL53 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4-(lS,3S,7S,10R,l 1S,12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9- dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-11 -yloxycarbonyloxymethyl]-2-chloro- phenyl ester (A) and 1 l-(2,5-Dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoic acid 4- (lR,3S,7S,10R,HS,12S,16S)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-ll- yloxycarbonyloxymethyl]-2-chloro-phenyl ester (B) Analogously to Example EL2, 28 mg (29 µmol) of the compound prepared according to Example EL52 are reacted. After working-up and purification, 6.2 mg (6.3 µmol, 22%) of the title compound A as well as 0.3 mg (0.3 µmol, 1%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.97 (3H), 1.04 OH). 1.23 (3H), 0.82-1.83 (25H), 2.16 (2H), 2.24-2.65 (7H), 2.72 (1H), 2.84 (3H), 3.50 (2H), 3.70 (1H), 4.08 (1H), 4.21 (1H)5 4.92 (1H), 4.97 (1H), 5.11 (2H), 5.22 (1H), 5.72 (1H), 6.25 (1H), 6.67 (2H), 7.12 (1H): 7.30 (1H), 7.37 (1H), 7.49 (1H), 7.83 (1H), 7.98 (1H) ppm. Example EL54 (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2~ methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-l 3-en-4-yl ester 4-[4-(2,5~ dioxo-2,5-dihydro-pyrrol-1 -yl)-3-nitro-butyrylamino]-benzyl ester Example EL54a (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-8-(tert-butyl-dimethyl-silanyloxy)- 5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13- en-4-yl ester 4-amino-benzyl ester Analogously to Example EL12b, 160 mg (227 µmol) of the compound prepared according to Example EL12a are reacted with 191 mg (4-amino-3-nitro-phenyl)- methanol. After working-up and purification, 51 mg (61 µmol, 27%) of the title compound are isolated. 1H-NMR (CDC13): δ = 0.07 (3H), 0.12 (3H). 0.92 (9H), 0.99 (3H), 1.03 (3H), 1.23 (3H), 0.85-1.74 (8H), 1.93 (1H), 2.28 (1H), 2.38 (2H), 2.49 (1H), 2.66 (1H), 2.77 (3H), 2.82 (1H), 2.97 (1H), 3.22 (1H), 3.87 (1H), 4.85-5.03 (4H), 5.22 (1H), 5.42 (1H), 5.74 (1H), 5.89 (1H), 6.10 (2H), 6.68 (1H), 7.19 (1H), 7.32 (1H), 7.73 (1H), 7.90 (1H), 7.98 (IH)ppm. Example EL54b (4S,7R,8S,9S,13Z,16S)-Carbonicacid7-allyl-8-(tert-buryl-dimethyl-silanyloxy)- 5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl )-2,6-dioxo-oxacyclohexadec-13- en-4-yl ester 4-[4-(2.5-dioxo-2,5-dihydro-pyrrol-l -yl)-butyryIamino]-3-nitro-benzy] ester 153 mg (837 µmol) of the compound prepared according to Example L4 are mixed with 1.82 ml thionyl chloride and refluxed for 3.5 hours. The mixture is diluted with toluene and evaporated. A solution of 130 mg (156 µmol) of the compound prepared according to Example 54a in 6 ml dichloromethane is added, 75 µl pyridine are admixed, and the mixture is stirred at 23°C for 16 hours. It is poured into water, extracted several times with dichloromethane, the combined organic extracts are washed with water and dried over sodium sulfate. After filtration and removal of the solvent, the residue is purified by chromatography. 101 mg (101 µmol, 65%) of the title compound are isolated. Example EL54 (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2- methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-[4-(2,5- dioxo-2,5-dihydro-pyrrol-l-yl)-butyrylaminoj-3-nitro-benzyl ester Analogously to Example ELI, 101 mg (101 µmol) of the compound prepared according to Example EL54a are reacted. After working-up and purification, 62 mg (70 µmol, 69%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.01 (3H), 1.14 (6H), 1.39 (2H), 1.64 (2H), 1.71 (3H), 1.80 (2H), 2.07 (2H), 2.23-2.54 (8H), 2.69 (1H), 2.77 (3H), 2.96 (1H), 3.39 (1H), 3.65 (2H), 3.69 (1H), 4.52 (1H), 4.75 (1H), 5.00 (1H), 5.05 (1H), 5.18 (1H), 5.55 (1H), 5.71 (1H), 5.98 (1H), 6.71 (2H), 7.31 (1H), 7.36 (1H), 7.77 (1H), 7.91 (1H), 7.93 (1H), 8.67 (1H), 10.28 (IH)ppm. Example ELS 5 (lS,3S,7S,10R,HS,12S,16R)-Carbonic acid 10-allyl-l l-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-butyrylamino]-3-nitro-benzyl ester (A) and (1R,3S,7S.10R,1 lS,12S,16S)-Carbonic acid 10-aJ]yl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-butyrylarnino]-3-nitro-benzyl ester (B) Analogously to Example EL2, 62 mg (70 µmol) of the compound prepared according to Example EL54 are reacted. After working-up and purification, 38 mg (42 µmol, 60%) of the title compound A as well as 11 mg (12 µmol, 17%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 1.03 (3H), 1.13 (3H), 1.17 (3H), 1.32 (3H), 1.20-2.58 (17H), 2.70 (1H), 2.79 (3H), 2.85 (1H), 3.43 (1H), 3.65 (2H), 3.69 (1H), 4.52 (1H), 4.72 (1H), 5.01 (1H), 5.05 (1H), 5.45 (1H), 5.70 (1H), 6.07 (1H), 6.71 (2H), 7.31 (1H), 7.35 (1H), 7.78 (1H), 7.88 (1H), 7.95 (1H), 8.68 (1H), 10.28 (1H) ppm. Example EL56 (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-8-hydroxy-5,5.9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-[6-(2,5-dioxo-2,5-dihydro-pyrrol-1 -yl)-hexanoylamino]-3-nitro-berizyl ester Example EL56a (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-8-(tert-butyl-dimethyl-silanyloxy)- 5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13- en-4-yl ester 4-[6-(2,5-dioxo-2,5-dihydro-pyrrol-l -yl)-hexanoylamino]-3-nitro-benzyl ester Analogously to Example EL54b, 50 mg (60 µmol) of the compound prepared according to Example EL54a are reacted with the compound prepared according to Example L5. After working-up and purification, 58 mg (56 µmol, 94%) of the title compound are isolated. Example ELS 6 (4S,7R,8S,9S,13Z,16S)-Carbonicacid7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2- methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-[6-(2,5- dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoylamino]-3-nitro-benzyl ester Analogously to Example ELI, 82 mg (80 µmol) of the compound prepared according to Example EL56a are reacted. After working-up and purification, 34 mg (37 µmol, 46%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.01 (3H), 1.14 (6H). 1.70 (3H), 1.31-2.57 (20H), 2.69 (1H), 2.78 (3H), 2.97 (1H), 3.39 (1H), 3.54 (2H), 3.69 (1H), 4.51 (1H), 4.74 (1H), 5.00 (1H), 5.05 (1H). 5.18 (1H), 5.55 (1H), 5.78 (1H), 5.98 (1H), 6.69 (2H), 7.31 (1H), 7.36 (1H), 7.76 (1H), 7.92 (1H), 7.93 (1H), 8.71 (1H), 10.32 (IH)ppm. Example EL57 (lS,3S,7S,10R,HS,12S,16R)-Carbonic acid 10-allyl-l l-hydroxy-8,8,12,16-tetramemyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 4-[6-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoylammo]-3-nitro-benzyl ester (A) and (1R,3S,7S,10R,1 lS,12S,16S)-Carbortic acid 10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3 -(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 4-[6-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-hexanoylarruno]-3-nitre-benzyl ester (B) Analogously to Example EL2, 34 mg .(37 µmol) of the compound prepared according to Example ELS 6 are reacted. After working-up and purification, 19 mg (20.4 u.mol, 55%) of the title compound A as well as 6 mg (6.4 µmol, 17%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 1.02 (3H), 1.14 (3H), 1.15 (3H), 1.39 (2H), 1.70 (3H), 1.65 (2H), 1.80 (2H), 2.06 (2H), 2.23-2.55 (8H), 2.69 (1H), 2.77 (3H), 2.97 (1H), 3.39 (1H), 3.65 (2H), 3.69 (1H), 4.52 (1H), 4.75 (1H), 5.00 (1H), 5.05 (1H), 5.18 (1H), 5.55 (1H), 5.71 (1H), 5.97 (1H), 6.71 (2H), 7.31 (1H), 7.36 (1H), 7.76 (1H), 7.91 (1H), 7.93 (1H), 8.68 (1H), 10.28 (IH)ppm. Example EL58 (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-[l l-(2,5-dioxo-2,5-dihydro-pyrrol-1 -yl)-undecanoylaminoJ-3-nitro-benzyl ester Example EL58a "' (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-8-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-[l l-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-undecanoylamino]-3-nitro-benzyl ester Analogously to Example EL54b, 130 mg (156 µmol) of the compound prepared according to Example EL54a are reacted with the compound prepared according to Example L6. After working-up and purification, 120 mg (109 µmol, 70%) of the title compound are isolated. Example ELS 8 (4S,7R,8S,9S,13Z,16S)-Carbonicacid7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-[l l-(2,5-dioxo-2,5-dihydro-pyrrol-1 -yl)-imdecanoylamino] ~3 -nitro-benzyl ester Analogously to Example ELI, 120 mg (109 µmol) of the compound prepared according to Example EL58a are reacted. After working-up and purification, 89 mg (90 µmol, 83%) of the title compound are isolated. 1H-NMR (CDC13): δ = l.Ol (3H), 1.13 (3H). 1.14 (3H), 1.70 (3H), 1.04-2.56 (30H), 2.69 (1H), 2.78 (3H), 2.97 (1H), 3.39 (1H), 3.50 (2H), 3.69 (1H), 4.52 (1H), 4.74 (1H), 5.01 (1H), 5.05 (IH), 5.18 (1H), 5.55 (1H), 5.71 (1H), 5.97 (1H), 6.67 (2H), 7.31 (1H), 7.36 (1H), 7.76 (IH), 7.91 (1H), 7.93 (1H), 8.72 (IH), 10.33 (IH)ppm. Example EL59 (lS,3S,7S,10R,HS,12S,16R)-Carbonicacid 10-allyl-ll-hydroxy-8,8,12,16- tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclo[14.1.0]heptadec-7-yl ester 4-[l l-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)- undecanoylamino]-3-nitro-benzyl ester (A) and (1R,3S,7S,10R,11S,12S,16S)- Carbonic acid 10-allyl-3 l-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5- yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 4-[ll-(2,5-dioxo-2,5- dihydro-pyrrol-l-yl)-undecanoylamino]-3-nitro-benzyl ester (B) Analogously to Example EL2, 89 mg (90 µmol) of the compound prepared according to Example EL58 are reacted. After working-up and purification, 45 mg (µmol, %) of the title compound A as well as 15 mg (µmol, %) of the title compound B are isolated. 1H-NMR (CDCl3) of A : δ = 1.03 (3H), 1.13 PHK i.ie (3H), 1.20-1.83 (26H), 2.09- 2.57 (8H), 2.72 (IH), 2.79 (3H), 2.86 (1H), 3.44 (1H), 3.50 (2H). 3.69 (1H), 4.51 (1H)5 4.72 (IH), 5.01 (IH), 5.05 (IH), 5.45 (IH), 5.71 (IH), 6.08 (IH), 6.68 (2H), 7.32 (1H); 7.35 (IH), 7.78 (IH), 7.88 (IH), 7.96 (IH), 8.73 (IH), 10.33 (IH) ppm. Example EL60 (4S,7R,8S,9S, 13Z,16S)-Carbonic acid 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-berizotbiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 6-(2.5-dioxo-2,5-dihydro-pyrrol-l-yl)-hexyl ester Example EL60a (4S,7R,8S,9S,13Z,16S)-Carbonicacid7-allyl-8-(tert-butyl-dimethyl-silanyloxy> 5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13- en-4-yl ester 6-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-hexyl ester Analogously to Example EL12b, 1.25 g (1.77 mmol) of the compound prepared according to Example EL12a are reacted with 1.75 g of the compound prepared according to LI 8. After working-up and purification, 119 mg (138 µmol, 8%) of the title compound are isolated. Example EL60 (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2- methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 6-(2,5-dioxo- 2,5-dihydro-pyrrol-1 -yl)-hexyl ester Analogously to Example ELI, 101 mg (117 µmol) of the compound prepared according to Example EL60a are reacted. After working-up and purification, 68 mg (91 µmol, 77%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.12-1.87 (19H), 1.70 (3H), 2.23-2.56 (6H), 2.66 (1H), 2.83 (3H), 2.97 (1H), 3.40 (2H), 3.48 (2H). 3.68 (1H), 3.75 (1H), 5.01 (1H), 5.05 (1H), 5.17 (2H), 5.51 (1H), 5.72 (1H), 5.97 (1H), 6.68 (2H), 7.35 (1H), 7.78 (1H), 7.92 (lH)ppm. Example EL61 (lS,3S,7S,10R,HS,12S,16R)-Carbonicacid 10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5.9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 6-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-hexyl ester (A) and (lR,3S,7S,10R,HS,12S,16S)-Carbonic acid 10-allyl-ll-hydroxy-8,8,12,16-terramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 6-(2,5-dioxo-2.5-dihydro-pyrrol-l-yl)-hexyl ester (B) Analogously to Example EL2, 68 mg (91 µmol) of the compound prepared according to Example EL60 are reacted. After working-up and purification, 26 mg (34 pmol, 37%) of the title compound A as well as 10 mg (13 µmol, 14%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 1.03 (3H), 1.14 (3H), 1.18 (3H), 1.32 (3H), 1.10-1.85 (15H), 2.11-2.43 (5H), 2.52 (1H), 2.70 (1H), 2.84 (3H), 2.86 (1H), 3.38-3.51 (4H), 3.69 (1H), 3.74 (1H), 5.01 (1H), 5.05 (1H), 5.42 (1H), 5.72 (1H), 6.07 (1H), 6.69 (2H), 7.32 (1H), 7.80 (1H), 7.90 (1H) ppm. Example EL62 (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l -yl)-3-nitro-butyrylamino]-benzyl ester Example EL62a (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-4-(tert-butyl-dimethyl-silanyloxy)- 5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13- en-8-yl ester 4-amino-benzyl ester Analogously to Example EL12b, 1.73 g (2.46 mmol) of the compound prepared according to Example EL14a are reacted with 2.06 g (4-amino-3-nitro-phenyl)- methanoi. After working-up and purification, 420 mg (502 µmol, 20%) of the title compound are isolated. 1H-NMR (CDC13): δ = -0.10 (3H), 0.09 (3H). 0.84 (9H), 0.96-1.21 (2H), 1.01 (3H), 1.12 (3H), 1.15 (3H), 1.70 (3H), 1.61-1.85 (4H), 2.11 (1H), 2.29 (2H), 2.54-2.78 (3H), 2.83 (3H), 2.90 (1H), 3.31 (1H), 3.93 (1H), 4.86 (1H), 4.96 (1H), 5.04 (1H), 5.11 (1H), 5.25 (2H), 5.55 (1H), 5.72 (1H), 6.14 (2H), 6.82 (1H), 7.35 (1H), 7.43 (1H), 7.79 (1H), 7.91 (1H), 8.18 (1H) ppm. Example EL62b (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-4-(tert-butyl-dimethyl-silanyloxy)- 5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13- en-8-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l -yl)-buryrylamino]-3-nitro-benzyl ester Analogously to Example EL54b; 140 mg (167 µmol) of the compound prepared according to Example EL62a are reacted with the compound prepared according to Example L4. After working-up and purification, 150 mg (150 jimol, 90%) of the title compound are isolated. Example EL62 (4S,7R,8S,9S, 13Z.16S)-Carbonic acid 7-allyl-4-hydroxy-5,5,9.13-tetramethyl-l 6-(2- methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-[4-(2,5- dioxo-2,5-dihydro-pyrrol-1 -yl)-3-nitro-butyrylamino]-benzyl ester Analogously to Example ELI, 145 mg (145 µmol) of the compound prepared according to Example EL62a are reacted. After working-up and purification, 67 mg (76 µmol, 52%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.08 (3H), 1.22 (3H), 1.70 (3H), 1.09-2.12 (8H), 2.27-2.55 (8H), 2.83 (3H), 2.87 (2H), 3.56 (1H), 3.65 (2H), 3.99 (1H), 4.93 (1H), 4.98 (1H), 5.12-5.26 (4H), 5.71 (1H), 5.83 (1H), 6.70 (2H), 7.33 (1H), 7.67 (1H), 7.79 (1H), 7.94 (1H), 8.25 (1H), 8.79 (1H), 10.32 (1H) ppm. Example EL63 (1S,3S,7S,10R,1 lS,12S,16R)-Carbonic acid 10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-ll-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-butyrylarnino]-3-nitro-benzyl ester (A) and (1R,3S,7S,10R,1 lS,12S,16S)-Carbonic acid 10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-l 1-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-butyrylamino]-3-nitro-benzyl ester (B) Analogously to Example EL2, 67 mg (76 µmol) of the compound prepared according to Example EL62 are reacted. After working-up and purification, 37 mg (41 µmol, 54%) of the title compound A as well as 12 mg (13 µmol, 18%) of the title compound B are isolated. Example EL64 (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-4-hydroxy-5,5,9J3-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-1 -yl)-3-nitro-hexanoylamino]-benzyl ester Example EL64a (4S,7R,8S,9SJ 3Z,16S)-Carbonic acid 7-allyl-4-('tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)- hexanoylamino]-3-nitro-benzyl ester Analogously to Example EL54b, 140 mg (167 µmol) of the compound prepared according to Example EL62a are reacted with the compound prepared according to Example L5. After working-up and purification, 155 mg (150 µmol, 90%) of the title compound are isolated. Example EL64 (4S,7R,8S,9S, 13Z, 16S)-Carbonic acid 7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2- methyl-benzothiazol-5-yl)-2,6~dioxo-oxacyclohexadec-13 -en-8-yl ester 4-[4-(2,5- dioxo-2,5-dihydro-pyrrol-1 -yI)-3 -nitro-hexanoylamino] -benzyl ester Analogously to Example ELI, 150 mg (151 µmol) of the compound prepared according to Example EL64a are reacted- After working-up and purification, 68 mg (74 µmol, 49%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.02 (3H), 1.07 (3H), 1.23 (3H), 1.70 (3H), 1.16-2.54 (20H), 2.84 (3H), 2.87 (2H), 3.54 (3H), 3.98 (1H), 4.92 (1H), 4.98 (1H), 5.13-5.26 (4H), 5.71 (1H), 5.83 (1H), 6.68 (2H), 7.33 (1H), 7.67 (1H), 7.79 (1H), 7.94 (1H), 8.26 (1H), 8.82 (1H), 10.37 (lH)ppm.58 Example EL65 (1S,3S,7S,10R,1 lS,12S,16R)-Carbonic acid 10-allyl-7-hydroxy-8,8,12,16-tetramethyl- 3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-11 -yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)- hexanoylamino]-3-nitro-benzyl ester (A) and (lR,3S,7S,10R,HS,12S,16S)-Carbonic acid 10-allyl-7-hydroxy-8,8,12,16- tetramethyl-3-(2-methyI-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclof 14.1.0]heptadec-11-yl ester 4-[4-(2,5-dioxo-2.5-dihydro-pyrrol-l-yl)- hexanoylamino]-3-nitro-benzyl ester (B) Analogously to Example EL2. 68 mg (74 (imol) of the compound prepared according to Example EL64 are reacted. After working-up and purification, 44 mg (47 µmol., 64%) of the title compound A as well as 3 mg (3 µmol, 4%) of the title compound B are isolated. Example EL66 (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yI)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-[4-(2.5-dioxo-2,5-dihydro-pyrrol-l -yl)-3-nitro-undecanoylamino]-benzyl ester Example EL66a (4S,7R,8S,9S,13Z,16S)-Carbonicacid7-allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13 -tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)- undecanoylamino]-3-nitro-benzyl ester Analogously to Example EL54b, 140 mg (167 µmol) of the compovmd prepared according to Example EL62a are reacted with the compound prepared according to Example L6. After working-up and purification, 165 mg (150 µmol, 90%) of the title compound are isolated. Example EL66 (4S,7R,8S,9S,13Z,16S)-Carbonic acid 7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl )-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-1 -yl)-3-nitro-undecanoylamino]-benzyl ester Analogously to Example ELI, 145 mg (132 µmol) of the compound prepared according to Example EL66a are reacted. After working-up and purification, 106 mg (108 µmol, 82%) of the title compound are isolated. 1H-NMR (CDC13): δ = 1.01 (3H), 1.06 (3H), 1.24 (3H), 1.70 (3H), 1.14-2.57 (30H), 2.82 (3H), 2.89 (2H), 3.50 (2H), 3.55 (1H), 4.01 (1H), 4.92 (1H), 4.99 (1H), 5.11-5.28 (4H), 5.70 (1H), 5.83 (1H), 6.69 (2H), 7.34 (1H), 7.67 (1H), 7.79 (1H), 7.96 (1H), 8.26 r(lH), 8.85 (1H), 10.38 (lH)ppm. Example EL67 (1S,3S,7SJOR,11SJ2S,16R)-Carbonic acid 10-allyl-7-hydroxy-8,8,12,16-tetramethy]-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-11 -yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)- undecanoylamino]-3-nitro-benzyl ester (A) and (lR,3S,7S,10R,HS,12S,16S)-Carbonic acid 10-allyl-7-hydroxy-8,8,12,16- tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclo[14.1.0]heptadec-l 1-yl ester 4-[4-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)- undecanoylamino]-3-nitro-benzyl ester (B) Analogously to Example EL2, 106 mg (108 µmol) of the compound prepared according to Example EL66 are reacted. After working-up and purification, 58 mg (58 µmol, 54%) of the title compound A as well as 6 mg (6 µmol, 6%) of the title compound B are isolated. 1H-NMR (CDC13) of A: δ = 0.96 (3H), 1.04 (3H), 1.23 (3H), 1.31 (3H), 0.81-1.83 (23H), 2.16 (2H), 2.23-2.66 (6H), 2.71 (1H), 2.85 (3H), 3.5 (2H), 3.72 (1H), 4.08 (1H), 4.24 (1H), 4.92 (1H), 4.97 (1H), 5.15 (2H), 5.22 (1H), 5.72 (1H), 6.25 (1H), 6.68 (2H), 7.36 (1H), 7.66 (1H), 7.83 (IE), 7.97 (IE), 8.25 (1H), 8.83 (1H), 10.37 (1H) ppm. Examples of the Synthesis of Effector-Linker Recognition Units (ELE) Example ELE1 [3-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-1 -yl)-propyl]-carbamic acid-10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[l4.1.0]heptadec-7-yl ester Example ELE la Reduction of an Antibody Fragment with Terminal Cysteine A single-strand protein that consists of the variable domains of the heavy and light antibody chains (single-chain Fv, scFv) of the amino acid sequence EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFSMSWVRQAPGKGLEWVSSISG SSGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKPFPYFDY WGQGTLVTVSSGDGSSGGSGGASEIVLTQSPGTLSLSPGERATLSCRASQSVSS SFLAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV YYCQQTGRIPPTFGQGTKVEIKGGGCA, which specifically recognizes the fibronectin domain B (ED-B) and is referred to as AP39, is used for coupling after reduction of the c-terminal cysteine. For reduction, the solution of 661 µg of tri(2-carboxyethyl)phosphine- hydrochloride in 236 µl of PBS is mixed with the solution of 1.54 mg of AP39 in 1.12 ml of PBS, and it is incubated for 1.5 hours at 25°C. Desalination is done with a pre- equilibrated NAP-5 column at a concentration of 450 µl of AP39r and 50 µl of PBS. After elution with 1 ml of PBS, the reduced antibody fragment AP39r is isolated in a concentration of 0.7 mg/ml. Example ELE1 (lS,3S,7S(3RS),10R,llS,12S,16R)-[3-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-propyl]-carbamic acid-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-7-yl ester 22.5 µl of a 1.38 mmol solution of effector-linker conjugate A in DMSO, prepared according to Example EL2, is added to 400 µl of the solution, prepared according to Example ELE la, of the reduced antibody fragment, mixed with 77.5 µl of PBS and incubated at 25°C for 1 hour. Desalination is done with a pre-equilibrated NAP5 column at a concentration of 500 µl of the reaction solution. After elution with PBS, the solution of the title compound is isolated The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26203.1 m/z (exp.): 26218 ± 20 Example ELE2 (1 S,3 S,7S(3RS), 1 OR, 11S, 12S, 16R)-[5-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-1 - yl)-pentyl]-carbamicacid-10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[ 14.1.0]heptadec-7-yl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL4, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26231.2 m/z (exp.): 26236 ± 20 Example ELE3 (lS,3S,7S(3RS),10R,llS.12S,16R)-[10-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyiTolidin-l-yl)-decyl]-carbamic acid-10-allyl-l 1 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[ 14.1.0]heptadec-7-yI ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL6, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26301.4 m/z (exp.): 26303 ± 20 Example ELE4 (1 S,3S,7S, 1 OR, 11 S(3RS), 12S, 16R)-[3-(3-(AP3 9r)-Sulfanyl-2,5-dioxo-pyrrolidin-1 -yl)-propyl]-carbamic acid-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[ 14.1.0]heptadec-11 -yl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example ELS, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26203.2 m/z (exp.): 26206 ± 20 Example ELE5 (lS,3S,7S,10RJlS(3RS);12S,16R)-[5-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-pentyl]-carbamicacid-10-allyl-7-hydroxy-8,8,12:16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[ 14.1.0]heptadec-ll-yl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL 10, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26231.2 m/z (exp.): 26225 ± 20 Example ELE6 (1 S,3 S(E),7S, 1 OR, 11S, 12S, 16R)-[3-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-1 -yl)-propyl]-carbamic acid-7-[3-(2,5-dioxo-2,5-dihydro-pyrrol-1 -yl)-propylcarbamoyloxy |-8,8,10,12,16-pentamethyl-3-[l -methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-l 1-yl ester (A) and (lS,3S(E),7S,10R,HS,12S,16R)-[3-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-propylj-carbamic acid-1 l-[3-(2,5-dioxo-2,5-dihydro-pyrrol-l-yl)-propylcarbamoyloxyj-8,8,10,12,16-pentamethyl-3-[l-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-7-yl ester (B) Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate that is prepared according to Example ELI 1, and the solution of the title compounds is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. ' m/z (Calc.): 26347.3 m/z (exp.): 26358 ± 20 Example ELE7 (lS,3S(E),7S,10R,HS,12S,16R)-N-[l-({4-[2-(7,11-Dihydroxy-8.8,10,12,16-pentamethyl-5.9-dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-3-yl )-propenyl]-thiazol-2-ylmethyl}-carbamoyl)-ethyl]-3-(AP39r)-disulfanyl-N-methyl-propionamide Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL16, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26173 m/z (exp.): 26174 ± 20 Example ELE8 (1 S,3S(E),7S, 1 OR, 11S. 12S, 16R)-2-[Methyl-(3-(AP39r)~disulfanyl-propionyl)-amino] -propionic acid-4-[2-(7,11 -dihydroxy-8,8,10.12,16-pentamethyl-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-3-yl)-propenyl]-thiazol-2-ylmethyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL 17, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26174 m/z (exp.): 26163 ± 20 Example ELE9 (1S,3S,7S,10R,1 lS,12S,16R)-Carbonic acid-10-allyl-l l-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester 4-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example ELI 3, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26238 m/z (exp.): 26224 ± 20 Example ELE10 (1 S,3S,7S, 1 OR, 11 S, 12S, 16R)-Carbonic acid-10-allyl-7-hydroxy-8,8,12,16-tetramethy]-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4.17-dioxa-bicyclo[14.1.0]heptadec-11 -yl ester 4-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL15, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26238 m/z (exp.): 26243 ± 20 Example ELE11 4-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-l-yr)-butanoic acid 4-(lS,3S,7S,10R,l IS, 12S, 16R)-[10-allyl-11 -hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)- 5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethyl]-2-nitro- phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL 19, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26383 m/z (exp.): 26377 ± 20 Example ELE12 4-(3-(AP39r)-Sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-butanoic acid 4- (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-[ 10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazor-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[I4.1.0]heptadec-ll- yloxycarbonyloxymethyl] -2-nitro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with effector-linker conjugate A that is prepared according to Example EL25, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26383 m/z (exp.): 26381 ± 20 Example ELE13 6-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-hexanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL21, and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26411 m/z (exp.): 26384 ± 30 m/z (Calc.): 25673 m/z (exp.): 25657 ± 20 (6-(3-(AP39r)-sulfanyl-2,5-dioxo- pyrrolidin-l-yl)-hexanoic acid fragment) Example ELE14 ll-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-undecanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-y})-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELE la is reacted with the effector-linker conjugate A that is prepared according to Example EL23 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26482 m/z (exp.): 26477 ± 20 m/z. (Calc.) : 25744 m/z (exp.): 26752 ± 20 (ll-(3-(AP39r)-sulfanyl-2,5-dioxo- pyrrolidin-l-yl)-undecanoic acid fragment) Example ELE 15 6-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-hexanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[ 14.1.0]heptadec-11 - yloxycarbonyloxymethyl] -2-nitro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELE la is reacted with the effector-linker conjugate A that is prepared according to Example EL27 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26411 m/z (exp.): 26398 ± 20 m/z (Calc.): 25673 m/z (exp.): 25665 ± 20 (6-(3-(AP39r)-sulfanyl-2,5-dioxo- pyrrolidin-l-yl)-hexanoic acid fragment) Example ELE 16 ll-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-undecanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-7-hydroxy-8.8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-l 1- yloxycarbonyloxymethyl]-2-nitro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL29 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26482 m/z (exp.): 26491 ± 20 m/z (Calc.) : 25744 m/z (exp.): 25757 ± 20 (ll-(3-(AP39r)-sulfanyl-2,5-dioxo- pyrrolidin-l-yl)-undecanoic acid fragment) Example ELE17 4-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-butanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl]-pheny] ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL31 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26338 m/z (exp.): 26304 ± 30 Example ELE 18 6-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-hexanoic acid 4-(1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-l l-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yloxycarbonyloxymethylj-phenyl ester Analogously to Example ELE1. the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL33 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26366 m/z (exp.): 26347 ± 30 Example ELE19 1 l-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-undecanoic acid 4- (1S,3S,7S,10R,11S.12S, 16R)-[10-allyl-l l-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yI)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl] -phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELE la is reacted with the effector-linker conjugate A that is prepared according to Example ELS 5 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26437 m/z (exp.): 26412 ± 30 Example ELE20 4-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-butanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-aIlyl-7-hydroxy-8,8,12,16-tetramethyI-3-(2-methyl-.benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-ll- yloxycarbonyloxymethyl] -2-nitro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELE la is reacted with the effector-linker conjugate A that is prepared according to Example EL37 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26338 m/z (exp.): 26338 ± 20 Example ELE21 6-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yI)-hexanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methy[- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-ll- yloxycarbonyloxymethyl] -phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELE la is reacted with the effector-linker conjugate A that is prepared according to Example EL39 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26366 m/z (exp.): 26384 ± 30 Example ELE22 1 l-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-undecanoic acid 4- (1 S,3S,7S,10R, 11S.12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyJ- benzothiazol-5-yl)-5,9-dioxo-4,l 7-dioxa-bicyclo[ 14.1.0]heptadec-11 - yloxycarbonyloxymethyl]-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL41 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26437 m/z (exp.): 26421 ± 30 Example ELE23 4-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-butanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-l l-hydroxy-8,8,12,16-tetramethyl-3-(2- • methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl]-2-chlorp-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL43 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26373 m/z (exp.): 26358 ± 20 m/z (Calc.) : 25645 m/z (exp.): 25627 ± 20 (4-(3-(AP39r)-sulfanyl-2,5-dioxo- pyrrolidin-l-yl)-butanoic acid fragment) Example ELE24 6-(3-(AP39r)-sulfanyI-2,5-dioxo-pyrrolidin-l-yl)-hexanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-ll-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl] -2-chloro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL45 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26401 m/z (exp.): 26395 ± 20 Example ELE25 1 l-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-undecanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-l l-hydroxy-8,8,12,16-tetramethyl-3-(2- methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7- yloxycarbonyloxymethyl ] -2-chlor-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL47 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.): 26471 m/z (exp.): 26463 ± 20 Example ELE26 4-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-butanoic acid 4- (1 S,3S,7S, 1 OR, 11S, 12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo [14.1.0]heptadec-11- yloxycarbonyloxymethyl] -2-chloro-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL49 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26373 m/z (exp.): 26341 ± 30 Example ELE27 6-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-hexanoic acid 4- (1S,3S,7S,10R,11S,12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-ll- yloxycarbonyloxymethyl] -2-chlor-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example ELS 1 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26401 m/z (exp.): 26391 ± 20 Example ELE28 1 l-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-undecanoic acid 4- (1 S,3S,7S, 1 OR,11S, 12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methy!- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-11 - yloxycarbonyloxymethyl]-2-chlor-phenyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example ELS 3 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26471 m/z (exp.): 26466 ± 20 Example ELE29 (1S,3S,7S,10R,1 lS,12S,16R)-Carbonic acid 10-allyl-l l-hydroxy-8,8,12,16- tetramethyl-3-(2-methyl-benzotbiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclo[14.1.0]heptadec-7-yl ester 4-[4-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1 - yl)-butyrylamino]-3-nitro-benzyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example ELS 5 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26337 m/z (exp.): ± 20 Example ELE30 (1S,3S,7S,10R,1 lS,12S,16R)-Carbonic acid 10-allyl-ll-hydroxy-8,8,12,16- tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclo[14.1.0]heptadec-7-yl ester 4-[6-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1 - yl)-hexanoylamino]-3-nitro-berizyl ester Analogously to Example ELE1. the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example ELS 7 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26365 m/z (exp.): ± 20 Example ELE31 (lS,3S,7S,10R,llS,12S,16R)-CarbonicacidlO-allyl-ll-hydroxy-8,8,12,16- tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclo[l4.1.0]heptadec-7-yl ester 4-[l 1 -(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-] - yl)-undecanoylamino]-3-nitro-benzyl ester Analogously to Example ELE1, the antibody fragment that is reduced according TO Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL59 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26436 m/z (exp.): ± 20 Example ELE32 (1S,3S,7S,10R,1 lS,12S,16R)-Carbonic acid 10-allyl-l l-hydroxy-8,8,12,16- tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa- bicyclo[14.1.0]heptadec-7-yl ester 6-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)- hexyl ester Analogously to Example ELE1, the antibody fragment that is reduced according to Example ELEla is reacted with the effector-linker conjugate A that is prepared according to Example EL61 and the solution of the title compound is isolated. The dilution factor relative to the antibody fragment is approximately 2.5. m/z (Calc.) : 26246 m/z (exp.): ± 20 Example ELE33 4-(3-(2H8-Ab)x-sulfanyl-2,5-dioxo-pyrrolidin-l-yl)-butanoic acid 4- (1 S,3S,7S, 1 OR, 11 S.12S, 16R)-[10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl- benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-l 1- yloxycarbonyloxymethyl] -2-nitro-phenyl ester 100 µl of a solution of the thionylated antibody prepared according to Example ELE33a (about 3 nmol, about 6 thiol groups) are mixed with 42.3 µl of a 1.1 mM solution of the effector-linker conjugate A prepared according to Example EL25 in PBS, and the mixture is incubated at 23°C for 1 hour. Desalination is performed by using a pre-equilibrated NAP5 column with a loading of 150 µl of the reaction solution. After elution with PBS. the solution of the title compound is isolated. The loading factor x of antibody 2H8-A in relation to effector-linker is about 1:4 to 1:5. Example ELE33a Thionylation of a complete immunoglobuline (IgG), e.g., the 2H8 antibody For the introduction of thionyl groups an amine-free solution of the 2H8 antibody in phosphate buffer having a concentration in the range of about 1-10 mg/ml at a pH of 7.2 is mixed with the 10- to 100-fold excess of 2-iminothiolane and is allowed to react for 1 hour at 23 °C. The number of the introduced thiol groups is 1 to about 15 depending on the excess of reagent. M3 WE CLAIM: 1. Effector conjugate of epothilone and epothilone derivatives of general formula (I): (Formula Removed) in which Rla Rlb, independently of one another, are hydrogen, C1-C10 alkyl, aryl, aralkyl, or together a -(CH2)m group, in which m is 2 to 5, R2a, R2b, independently of one another, are hydrogen, C1-C10 alkyl, aryl, aralkyl, or together a -(CH2)n group, in which n is 2 to 5, or C2-C10 alkenyl, or C2-C10 alkynyl, R3 is hydrogen, C1-C10 alkyl, aryl or aralkyl, and R4a, R4b, independently of one another, are hydrogen, C1-C10 alkyl, aryl, aralkyl, or together a -(CH2)p group, in which p is 2 to 5, R5 is hydrogen, C1-C10 alkyl, aryl, aralkyl, CO2H, CO2alkyl, CH2OH, CH2Oalkyl, CH2Oacyl, CN, CH2NH2, CH2N(alkyl, acyl)i,2, or CH2Hal, Hal is a halogen atom, ^ \\\A- R6, R7 in each case are hydrogen, or together an additional bond, or together an oxygen atom, or together an NH group, or together an N-alkyl group, or together a CH2 group, and G is an oxygen atom or CH2, D-E is a group H2C-CH2, HOCH, C=C, CH(OH)-CH(OH), CH(OH)-CH2, (Formula Removed) CH2-CH(OH), HC-CH , O-CH2, or, if G represents a CH2 group, D- E is also CH2-O, W is a group C(=X)R8, or a bicyclic or tricyclic aromatic or heteroaromatic radical, L3 is hydrogen, or, if a radical in W contains a hydroxyl group, forms a group O-L4 with the latter, or, if a radical in W contains an amino group, forms a group NR25-L4 with the latter, R25 is hydrogen or C1-C10 alkyl, X is an oxygen atom, or two OR20 groups, or a C2-C10 alkylenedioxy group that may be straight or branched, or H/OR9, or a CR10Rn group, R8 is hydrogen, C1-C10 alkyl, aryl, aralkyl, halogen or CN, and R9 is hydrogen or a protective group PGX, nr R10, R11, in each case independently of one another, are hydrogen, C1-C20 alkyl, aryl, aralkyl, or together with a methylene carbon atom form a 5- to 7-membered carbocyclic ring, Z optionally represents oxygen or H/OR12, R12 optionally represents hydrogen or a protective group PGZ, A-Y optionally represents a group O-C(=O), O-CH2, CH2-C(=O), NR21- C(=O) or NR21 -SO2, R20 optionally represents C1-C20 alkyl, R21 optionally represents a hydrogen atom or C1-C10 alkyl, PGX, PGY, and PGZ optionally represent a protective group PG, and L1, L2, and L4, independently of one another, optionally represents hydrogen, a group C(=O)C1, a group C(=S)C1, a group PGY or a linker of general formula (IE) or (IV); provided that at least one substituent L1, L2 or L4 represents a linker of general formula (ID) or (IV); the linker of general formula (III) has the following structure, (Formula Removed) in which T optionally represents oxygen or sulfur, U optionally represents oxygen, CHR22, CHR22-NR23-C(=O)-, m O-C(=O)-CHR22-NR23-C(=O)-, O-C(=O)-CHR22-NR23-C(=S)-, CHR22-NR23-C(=S)- or NR24a, o can represents 0 to 15, V optionally represents a bond, aryl, a group (Formula Removed) or a group (Formula Removed) s optionally represents 0 to 4, Q optionally represents a bond, O-C(=O)-NR24c, O-C(=S)NR24c, (Formula Removed) ,or R22 optionally represents hydrogen, C1-C10 alkyl, aryl or aralkyl, R23 optionally represents hydrogen or C1-C10 alkyl, R24a, R24b; and R24C5 independently of one another, optionally represents hydrogen or C1-C10 alkyl, q optionally represents 0 to 15, FG1 optionally represents C1-C10 alkyl-S3, (Formula Removed) ' or CO2H; and the linker of general formula (TV) has the following structure, (Formula Removed) in which T optionally represents oxygen or sulfur, W1, W2 are the same or different and optionally represents oxygen or NR24a; o optionally represents 0 to 5, R24a optionally represents hydrogen or C1-C10 alkyl, R27 optionally represents halogen, CN, NO2, CO2R28, or OR28, R28 optionally represents hydrogen, C1-C10 alkyl, aryl or aralkyl, q optionally represents 0 to 5, U optionally represents oxygen, CHR22, CHR22-NR23-C(=O)-, . ni- CHR22-NR23-C(=S)- or C1-C20 alkyl, R22 optionally represents hydrogen, C1-C10 alkyl, aryl or aralkyl, R23 optionally represents hydrogen or C1-C10 alkyl, r optionally represents 0 to 20, FG1 optionally represents C1-C10 alkyl-S3, (Formula Removed) as a single isorner or a mixture of different isomers and/or as a pharmaceutically acceptable salt thereof. 2. Effector conjugate as claimed in claim 1, wherein: A-Y represents O-C(=O) or NR21 -C(=O), D-E represents an HaC-CH2 group, G represents a CHa group, Z represents an oxygen atom, Rla, Rlb in each case represent C1-C10 alkyl or together a -(CH2)p group with p equal to 2 or 3 or 4, R2a, R2b, independently of one another, represent hydrogen, C1-C10 alkyl, C2-C10 alkenyl, or C2-C10 alkynyl, R3 represents hydrogen, R4a, R4b, independently of one another, represent hydrogen or C1- C10 alkyl;_ R5 represents hydrogen, or C1-C4 alkyl or CH2OH or CH2NH2 or CH2N(alkyl, acyl)1,2 or CH2Hal, R6 and R7 together represent an additional bond or together an NH .gmup or together an N-alkyl group, or together a CH2 group, or together an oxygen atom, W represents a group C(=X)R8 or a 2-methylbenzothiazol-5-yl radical or a 2-methylbenzoxazol-5-yl radical or a quinolin-7-yl radical or a 2-aminomethylbenzothiazol-5-yl radical or a 2-hydroxymethylbenzothiazol-5-yl radical or a 2-aminomethyl- benzoxazol-5-yl radical or a 2-hydroxymethylbenzoxazo]-5-yl radical, X represents a CR10Rn group, R8 represents hydrogen or C1-C4 alkyl or a fluorine atom or a chlorine atom or a bromine atom, R10/Rn represent hydrogen/2-methylthiazol-4-yl or hydrogen/2-pyridyl or hydrogen/2-methyloxazol-4-yl or hydrogen/2-aminomethylthiazol-4-yl or hydrogen/ 2~aminomethyloxazol-4-yl or hydrogen/2- hydroxymethylthiazol-4-yl or hydrogen/2-hydroxymethyloxazol-4-yl. 3. Effector conjugate as claimed in date 1 or 2, wherein the effector element is selected from the group that consists of: (4S, 7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-l 6-[2-(2-hydroxymetfayl-thiazol-4-yl)-l-methyl-vinyl]-5,5,7,9,13-pentamethyl-oxacycloliexadec-13-ene-2,6-dione; (4S,7R, 8S,9S,13Z, 16S(E))-16-[2-(2-Aminometliyl-thiazol-4-yl)-l -methyl-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-I3-ene-2,6-diorte; (1 S,3 S(E),7S,1 OR, 11 S,12S,16R)-7,1 l-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1 -methyl-2-(2-raethyl-thiazol-4-yI)-vinyl]-4J 17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dtone; (! S,3 S(E),7S, 1 OR, 11S, 12S, 16R)-7,1 l-Dmydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -methyI-vinyl]-8, 8,10,12,16-pentamethyl-4,17-dioxa-bicyclof 14.1.0]heptadecane-5,9-dione; (1 S,3S(E),7S,1 OR, 11 S,12S,16R)-3-[2-(2-AmirethyI-thiazo3-4-yl)-l -methyl-vinylJ-7,11 -dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-3 6-f 1 -methyl-2-(2-inethyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-l 6-[2-(2-hydroxytttethyl-thiazoI-4-yi)-1 -methyl- vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-l 3-ene-2,6-dione; (4S57R, 8S,9S, 13Z, 16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1 -methyl-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-l3-ene-2,6-dione; (1S,3SCE),7S,J OR,1 lS,12S,16R)-73ll-Dihydroxy-10-efhy]-8,8312,16-tetramethyl-3-f 1 -methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-blcyclo[14.1.0]heptadecane-5,9-dione; (1S,3S(E),7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-[2-(2-iydroxymethyl-tkiazol-4-yl)-l-methyl-vinyl]-lO-e1iiyl-8,8,l2,l6-telfametiiyl-4Jl7-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione; (iS,3S(E),7S3lOR,llS,l2S,l6R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-r-me1iiyl-vinyl]-7, 11 -dihydroxy-1O-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo [14.1.0]hepta-decane-5,9-dioce; (4S,7R,8S,9S,13Z,l6S(Z))4,8-Dihydroxy-5.5,7,9,13-pentamethyl-16-[l-fluoro-2-(2-rnetIiyl-thiazol-4-yl)-vinyl]-oxacycloIiexadec-13-ene-2,6-dione; (4SJ7R,8S,9S,13Z,16S(Z))-4,8-Diliydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -fluoro-vinylJ-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(Z))-16-[2-(2-Ammomethyl-thiazol-4-yl)-l -fluoro-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-diotie; (1 S,3 S(Z),7S, 1 OR, 11S, 12S, 16R)-7,1 l-Dihydroxy-8,8,10,12,16-pentamethyl-3-[l-fluoro-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1,0]heptadecane-5,9-dione; (IS,3S(Z),7S,10R,llS,12S,16R)-7,ll-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -fluoro-vinyl]-8,8,10,12,16~pentametfiyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1 S,3 S(Z),7S,1 OR,11 S, 12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-l-fluoro-vinyl]-7; 11 -dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyc!o[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-chloro-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9SJ13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-liydroxymethyl-thiazol-4-yl)-l-chloro-viayl]-5,5,7,9,13-pentamethyl-oxacycloliexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazolol-4-yl)-l-chlolo-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentameth.yl-oxacycIohexadec-l 3-ene-2,6-dione; (1 S,3 S(Z),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3-[1 -chloro-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bIcyclo[14.1.0]heptadecane-5,9-dione; (1S,3S(Z),7S,10R511S,12S,16R)-7,1 l-Dihydroxy-3-[2-(2-liydroxymethyl-thiazol-4-yl)-l -chloro-vinyl]-8,8,l 0,12,16-pentamethyl-4317-dioxa-bicyclo[14.1.0]heptadecane-5.,9-dione; (lS,3S(Z),7S,10R,llS,12S,16R)-3-[2-(2-Aminomethyl-ttuazol-4-yl)-l-chloro-vinyl]-7,11 -dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l-fluoro-2-(2-metfayl-thiazolol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1 -fluoro-vinyI]-7-ethyl-5,5,9,13-tetramethyi-oxacyclohexadec-l 3-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-l-fluoro-VLnyl]-4,8-dihydroxy-7-ethyI-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (1S,3S(Z),7S, tOR,l lS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethy]-3-[l -fluoro-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione; (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)7,1 l-Dihydroxy-3-[2-(2-hydroxymethyl~ thiazol-4-yl)-1 -fluoro-vinyl] -10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione; (lS,3S(Z),7S,10R,llS,12S,16R)-3-[2-(2-Aminometliyl-thiazol-4-yl)-l-fIuoro-vinyI]-7,11 -dfhydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]b.epta-decane-5,9-dione; (4S,7R, 8S,9S, 132,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9313-tetramethyl-l 6-[l -chIoro-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4SJR,8S,9S,13Z,16S(Z)-4,8-Dihydroxy-16-[2-(2-hydroxymeJiiyl-thiazol-4-yl)-1 -chloro-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13 -ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(Z))-16-[2-(2-Aminometiiyl-thiazol-4-yl)-l -chloro- vinyl] -4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacycloliexadec-13-ene-2.,6-dione; (1 S,3S(Z),7S, 1 OR, 11 S,12S, 16R)-7,11-Dihydroxy-l O-ethyl-8,8,12,16-tetramethyI-3-[l -chioro-2-(2-methyI-thiazoI-4-yI)-vinyl]-4,l 7-dioxa-bicyclof 14.1.0]heptadaoane-5,9-dioue; (1 S,3 S(Z),7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3-[2-(2-hydroxymetliyl-thiazol-4-yl)-i-chloro-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,l7-idioxa-bicyclo[14.1.0]hepta-decane-5,9-dione; (1 S,3 S(Z),7S, 1 OR, 11 S, 128,16R)-3~[2-(2-Aminomethyl-thiazolol-4-yl)-l-chloro-vinyl]-7, i 1 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentametIiyl-16-[l-methyl-2-(2-pyridyl)- vinylj-oxacyclohexadec-13-ene-2,6-dione; (1 S,3 S(E),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3 -[I -methyl-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]Jieptadecane-5,9-dione; r4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,l3-tetramethyl-16-[l-methyl-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (1S,3S(E),7S,10R,11S,12S,16R0-7,1 l-Diliydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l-methyl-2-(2-pyridyl)-vinyl]-4.,17-dioxa-bicyclo[14.1.0]heptadecaiie-5,9-dione; ('4S37R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,537,9,13-pentamethyl-16-[I-fluoro-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2J6-dione; (lS,3S(Z),7S,10I^llS,12S,16R0741-Dmydroxy-8,8,10,12,16-pentamefhyl-3-[1 -fluoro-2-(2-pyridyl)-vinyl]-4, 17-dioxa-bicycIof 14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[l-chloro-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-eiie-2,6-dione; (lS,3S(Z),7S,10RJHS,12S,16R)-7,ll-Dihydroxy-8,8,10,12J16-pentamethyI-3-[ 1 -c3iIoro-2-(2-pyridyl)-vinyl]~4,17-dioxa-bicyc]o[] 4.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyI-5,5,9,13-tetramethyl-16-[l-fluoro-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-eiie-2,6-dione; CIS,3S(Z),7S,IOR,IlS,12S,16R)-7,lI-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l -fluoro-2-(2-pyridyl)-vinyl]-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,]6S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[l-chloro-2-(2-pyridyI)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (1 S,3S(Z),7S,1 OR,11 S,12S,16R)-7,11 -Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l -chloio-2-(2-pyridyl)-vinyl]-4,17~dioxa-bicyclo[l4.1 .OJheptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S(E))4,8-Dihydroxy-5,5,7,9,13-pentametliyl-16-[l-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S;7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yJ)-l-methyl-vinyl]-5,5,7,9,13-pentamethyl-oxacycloliexadec-13-enei-2,6-dione; (4S,7R,8S,9S513ZJ16S(E))-16-[2-(2-Aminomethyl-oxazol-4-yl)-l-methyl-vmyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione; (lS,3S(E),7SJOR,nS,i2S,16R)-7Jll-Dihydroxy-838310,12J6-pentamethyl-3-[1 -methyl-2-(2-methy]-oxazol-4-yl)-vinylJ-4,17-dioxa-bicycJo[14.1.0]heptadecane-5,9-dione; (1 S,3S(E),7S,WR,11S,12S,16R)-7,1 l-Dihydroxy-3-[2-(2-hydroxymethyl-oxazo1-4-yl)-1 -methyl-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]}ieptadecane-5,9-dione; (lS,3S(E),7S,10R,HS,12S,16R)-3-[2-(2-AminomethyI-oxazol-4-yl)-l-methyl-vinyl]-7,11 -dihydroxy- 8,8,10,12,16-pentamethyl-4,17-dioxa-bicydo[l 4.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-13-tetramethyl-16-[1-" methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-l-niethyl-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-i3-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(E))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1 -methyl-vinyl]-4,8-dihydroxy-7-ethyl-5,5,,9,l 3-tetramethyl-oxacyclohexadec-l 3-ene-2,6-dione; (lS,3S(E)JS,10R,llS,12S,16R)-7,ll-Dihydroxy-10-ethyM,8,12,16-tetramethyl-3-[l-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioXa-bicycio[i4.i.O]heptadecane-5,9-dione; (lS,3S(E),7S,10R,HS,12S)16R)-7,ll-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-l-methyl-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-didxa-bicyc!o[14.1.0]hepta-decane-5,9-dione; (lS,3S(E),7S,10R,HS,12S,16R)-3-[2-(2-AminometIiyl-oxazol-4-yl)-l-met]iyl-vinyi]-7,ll-dihydroxy-10-ethyl-8,8,12,16-tetramethyj-4,17-dioxa-bicycio[14.1.0]hepta-decane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-l 6-[l-fluoro-2-(2-metliyl-oxazo]-4-yl)-vinyl]-oxacyclolaexadec-13-eiie-2,6-dione; (4S,7R,8SJ9S,13Z,16S(Z))-4,8-Dihydxoxy-I6-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -fluoro-vinylJ-5,5,7,9,13-pentametfa.yl-oxacycloiiexadec-13-ene-2,6-dione; (4S,7R, 8S,9S, 13Z, 16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1 -fluoro-vuiyl]-4,8-dihydroxy-5,5,7,,9,13-pentamethyl-oxacycIoiiexadec-13-ene-2,6-dione; (lS,3S(Z),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-[l-fIuoro-2-(2-methyl-oxazoI-4-yI)-vinyI]-4,17-dioxa-bicyclo[14.LO]heptadecane-5,9-dione; (I S,3 S(Z),7S, 1 OR, 11S, 12S, 16R)-7311 -Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-l -fluoro-vinyl]-8,8,10,12,16-pentamethyl-4,l 7-dioxa-bicycIo[14.1.0]heptadecane-5,9-dione; (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-l -fluoro-vinyl]-7,i l-dihydroxy-8,8,10,12,16-pentamethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyM 6-[l-chloro-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13ZJ16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1 -chloro-vinylj-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-l -chloro-vinyl]-4,8-dIhydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione; (lS,3S(Z),7S,10R,llS,12S,16R)-7,ll-Dihydroxy-8,8,10)12,16-pentaEethyl-3-[ 1 - chloro-2- (2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione; (1 S,3 S(Z),7S,1 OR, 11 S, 12S, 16R)7,1 l-Diiydroxy-3-[2-(2-l1ydroxymethyl-oxazol-4-yl)-1 -chloro-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicycJo[14.].0]ieptadecane-5,9-dione; (lS,3S(Z),7S,10R3llS,12S,16R)-3-[2-(2-Aminoinethyl-oxazol-4-yl)-l-chloro-vinyl]-7,11 -dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-l 6-[l -fluoro-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(Z))-4,8-Dlhydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-l -fliioro-vinyl]-7-ethyl-5.,5.,9,13-tetratneihyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Ammomethyl-oxazol-4-yl)-l-fluoro-vinyl]-4;,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (13,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[l-fluoro-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[] 4.1 .0]heptadecane-5,9-dione; (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3 -[2-(2-hydroxymethyl-oxazol-4-yl)-l-fIuoro-vinyl]10-ethyl-8,8J2,16-tetramethyl-4,17-dioxa-bi cy clo [14.1.0]hepta-decane-5,9-dione; (1 S,3 S (Z),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-l -fluoro-vinyl]-7,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]hepta-decane-5,9-dione; (4S,7R, 8S,9S, 13Z, 16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,l 3-tetramethyl-l 6-[l -chloro-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacycloliexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-vl)-1 -cliloro-vlnyl]-7-ethyl-5,5,9,13-tetramethyl-oxacycloliexadec-13-ene-2,6-dione; (4S,7R, 8S,9S,13Z, 16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-l -chloro-vinylj-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacycloh.exadec-13-ene-2,6-dione; (lS,3S(Z),7S,10R,11S,2S,Id[R3-7,11-Daydroxy-10-etiiyl-8,8,12,16-tetramethyl-3-[l -chIoro-2-(2-methyl-oxazol-4-yl)-vinyJ]-4,l 7-dioxa-bicycIo[14.1.0Jheptadecane-5,9-dione; (1 S,3 S(Z),7S, 1 OR, 11S, 12S.16R)-7,1 l-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yi)-1 -chloro-vinylj-10-ethyI-8,8,12,16-tetramethyl-4,17-dioxa-bicycJo[14.1.0]hepta-decane-5,9-dione,- (1 S,3 S(Z),7S, 1 OR, 11 S, 12S, 16R)-3-[2-(2-Amiaomethyl-oxazol-4-yl)-1 -chloro-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyI-4,17-dioxa-bicyclo[]4,1.0]hepta-decane-5,9-dione; (4S,7R,8S,9S,13Z, 16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-l 6-[2-(2~ raethyi-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-y I)-vinyl] -5,5,7,9,13 -pentamethyl-oxacycloliexadec-13 -ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8--dihydroxy-5.5,7,9,13~pentainethyl-oxacyclohexadec-13-eiie-2,6-dione; (1S ,3 S(E),7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-8,8,10,12,16-pentamethyl-3-[2-(2-methyl-tbiazoI-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (lS,3S(E),7S,10R,llS,12S,36R)-7,ll-Dihydroxy-3-[2-(2-hydroxymethy]-thiazol-4-yl)-vinyl]-8,8,10,12,16-pentamethyl-4,17-d:oxa-bIcyclo [14.1.0]heptadecane-5,9-dione; (lS,3S(E),7S,10R,nS,12S,16R)-3-[2-(2-Aminometliyl-thiazol-4-yl)-vinyl]-7,11 -diiydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicycIo[14.1.0]Keptadecane-5,9-dione; (4S, 7R, 8S,9S, 13Z, 16S)-4,8-Dihydroxy-l 6-(2-hydroxymethyl-benzothiazol-5-yl)-5,5,7,9,13 -pentamethyl-oxacyclohexadec-13 -ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S0-16-(2-Aminomethyl-benzothia2ol-5-yI)-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dione; (lS,3S,7S40R,nS,12S,6R0-7,ll-D%droxy-8,840J2,lfrpentamelh.yl-3-(2-methyl-ben2othiazol-5-yl)-4,17-dioxa'bicyclof 14.1.0]heptadecane-5,9-dione; (1 S,3S,7S,1 OR, 11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzothiazoI-5-yl)-8,8,10,12,16-pentamethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (lS,3S,7S,10R3llS,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,ll-dihydroxy-8,8,10,12,16-pentamethyI-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S, 7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-l 6-(2-hydroxymethyJ-benzothiazol-5- yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (4S, 7R,8S,9S, 13Z, 16S)- 16-(2-Aminomethyl-benzothiazoI-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacycloliexadec-13-ene-2,6-dlone; (1 S,3 S,7S, 1 OR, 11S, US, 16R)-7,11 -Dib.ydroxy-10-ethyl-8,8,12,16-tetramethy]-3-(2-meth.yl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecafaB-5,9-dione; (1S53S,7S,1 OR,11S,12S,16R)-7,n-Dihydroxy-3-(2-hydroxymethyJ-benzothiazol-5-yl)-l0-ethyl-8,8,12,16-tetramethyl-4,l 7-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S(E))-4,8-Diliydroxy-7-ethyl-535>9)13-tetramethyl-16-[2-(2-methyI-thiazol-4-yl)-vmyl]-oxacycloliexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,i6S(E))-4,8-Dihydroxy-i6-[2-(2-liydroxymethyl-thia2:ol-4-yl)-vinyJ]-7-ethyl-5,5,9313-tetramethyl-oxacydoliexadec-J3-ene-2,6-dione; (4S,7R38S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacycIohexadec-l 3-ene-2,6-dione; (lS,3S(E),7S,10R,nS,12S,16R)-7,n-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[2-(2-naethyl-thiazol-4-yl)-vinyl]-4,,17-dioxa-bicyclo[14.1.0]heptadecane-5,9~dione; (1 S,3 S(E),7S, 1 OR, 11S, 12S, 16R)-7,1 l-Dihydroxy-3-[2-(2-hydroxymethyI-thiazol-4-yl)-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1 S,3S(E),7S, 1 OR, 11 S,12S, 16R)-3-[2-(2-Ammomethyl-thiazol-4-yl)-viny]]-1,11 -dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentdmethyl-l 6-[2-(2-pyridyl)-viny]]-oxacyc]ohexadec-13-ene-2,6-dione; (lS)3S(E),7S,10R,llS,12S,16R)-7,ll-Dihydroxy-8,8,10,12,16-pentamethyl-3-[2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9SJ13Z,16S(E))-4,8-Dihydroxy-7-ethyJ-5,5,9,13-tetrametliyl-16-f2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dione; (lS>3S(E),7S,10R,HS,12S,16R)-7,ll-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3 - [2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione; (4S;7R,8S,9S,13Z,16S)-4,8-Dihydroxy-5,5,7,9,13-pentametilyl-16-(2-methy]-benzofhiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione; (lS,3S,7S,10R,llS,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,ll-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]lieptadecane-5,9- dione (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2.,6-dione; (4S, 7R, 8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-propyl-5,5,9,13-tetramethyl-oxacydohexadec-13-ene~2,6-dione; (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10-propyl-8,8,12,16-te1xarneth.yl-3-(2-inethyl-benzothiazol-5-yl)-4)l7-dioxa-bicyclo[l4.l.O]heptadecane-5,9-dione; (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyI-benzothiazoI-5-yl)-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1 S,3S,7S, 1 OR,11 S,12S, 16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,l 1-dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-butyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5 -yl)-oxacyclohexadec-13 -ene-2,6-dione; (4SJR,8S,9S,13ZJ6S)-4,8-Dihydroxy-16-(2-hydroxymeihyl'benzothiazol-5' yl)-7-butyl-5,5,9,13-tetraraethyl-oxacyclohexadec-13-ene-2,6-dione,- (4S,7R,8 S.9S, 13Z, 16S)- 16-(2-Aminometliyl-benzothiazol-5-yl)-4,8-diliydroxy-7-butyI-5,5,9,13-tetramethyl-oxacyclo]iexadec-13-ene-2,6-dione; (1 S,3S,7S, 1 OR, 11S, 128,16R)-7,11-Dihydroxy-l O-butyl-8,8,12,16-tetramethyl-3-(2-methyl-beiizothia2ol-5-yl)-4,17-dioxa-bicyclo[14.]heptadecane-5,9-dione; (1 S,3S,7S,1 OR,11S,12S,I6R)-7,1 l-Biliydroxy-3-(2-hyciroxyraethyl-benzothiazol-5-yl)-1O-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione; (1 S,3S,7S, 1 OR, 11 S, 12S,16R)-3-(2-Aminomethyl-ben2othiazol-5-yl)-7,l 1 -dihydroxy-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z,.l 6S)-4,8-Dihydroxy-7-allyl-5,5,9,13-tetramethyl-l 6-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13 -ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzotbiazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S)-16-(2-Aminomethyl-ben2othiazol-5-yl)-4,8-dihydroxy-7-ally 1-5,5,9,13-tetramethyl-oxacycloliexadec-13-ene-2,6-dione; (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10-allyl-8,8,lil6-tetTamethyl-3-(2-methyl-ben2othiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1 S,3S,7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3 -(2-hydroxymethyl-benzothiazol-5-yl)-l O-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5.,9-dione; (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,l 1-dihydroxy-10-allyl-8,8,12,16-tetrametliyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxyniethyl-ben2othiazol-5-yl)-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacycloliexadec-13-ene-2,6-dione; C4S,7R,8S,9S,I3Z,16S)-16-C2-Anrbomethyi-beaizothiazoI-5-yI)-4,8-dihydroxy-7-prop-2-inyl-5.,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (lS,3S,7S,10R,11S,12S,16R)-7,n-Dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzofhiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1S,3S,7S,10R, 1S,12S,16R)-7,1 l-Dlhydroxy.3-(2-hydroxymethyl-benzothiazol-5 -yl)-l 0-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa- bicyclo[14.1.0]heptadecane-5,9-dione; (1 S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzotbiazol-5-yl)-7;,l 1-dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione; (4S,7R, 8 S,9S, 13Z, 16S)-4,8-Dihydroxy-7-but-3 -enyJ-5,5,9,13 -tetramefhyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dmydroxy-16-(2-liydroxymethyl-beiizothiazol-5-yl)- 7-but-3 -enyl-5,5,9,13-tetramethyl-oxacycIohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzotbiazol-5-yl)-4,8-diliydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione,- (lS,3S,7S,10R,HS,12S,16R)-7,ll-Diliydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,,9-dione; (lS,3S,7S,10R,llS!12S,16R)-7,ll-Diliydroxy-3-(2-hydroxymetliyl-benzotbiazol-5-yl)-10-but-3-enyl-8J8,12316-tetramethyI-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione; (lS)3S,7S,10R,llS,12SJ6R)-3-(2-Aminomethyl-benzothiazoI-5-yI)-7,ll-dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione; (4S,7R, 8S,9S, 13Z, 16S)-4,8-Dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-16-(2-rnethyl-benzothiazol-5-yl)-oxacyelohexadec-13-ene-2,6-dione; (4S,7R,8S,9S513Z,16S)-4,8-Diliydroxy-16-(2-liydroxymethyl-benzothiazol-5-yl)-7-but-3-inyl-5.,5,9,13-tetramethyl-oxacyclob.exadec-13-ene-2,6-dione; (4S,7R,8S,9S313Z,16S)46-(2-Amiriomethyl-benzotbjazoI-5-yl)-4,8-diliydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (lS,3S,7S,10R,HS,12S,16R)-7,ll-DiIiydroxy-10-but-3-inyl-858,12,16-tetramethyl-3-(2-methyl-benzotfaiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]lieptadecane-5,9-dione; (1 S,3 S,7S, 1 OR, 11S, 12S, 16R)-7,11 -Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-l 0-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzothiazoJ-5-yl)-7,l 1-dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5.,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-eaie-2,6-dione; (4S,7R,8S,9S,l3Z,l6S)-4,8-Dihydroxy-l6-(2-hydroxyine1iiyl-beiizoxazol-5-yl)-5,5,7,9.,13-peiitamethyl-oxacyclohexadec-13-eiie-2,6-dIoi)e; (4S57R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazo]-5-yl)-4,8-dibydroxy-5,5,7,9,13 -pentamethyl-oxacyclahexadec-13 -ene-2,6-dione; (lS,3S,7S,10R,llS,12S,16R)-7,11-Dihydroxy-838310,12,16-pentainethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (lS,3S,7S,10R,i 1S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,l 1-dihydroxy- 8,8,10,12,16-pen.tajmeth.yl-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-l6-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 132,16S)-4,8-Diliydroxy-l 6-(2-hydroxymethyl-benzoxazol-5-yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,132,16S)-16-(2-Aminomethyl-benzoxazo]-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13 -tetramethyl-oxacyclohexadec-13 -ene-2,6-dione; (lS,3S,7S,10R,HS,12S,16R)-7,ll-Diliydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzoxazbl-5-yl)-7,l 1-dih.ydroxy-10-ethyl-8,8>12,16-tetrametliyl-4,17-dioxa-bicyclo[14.1.d]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-16-(2-methyl-ben2;oxazol-5-yl)- (4S,7R,8S,9S,13Z,16S)-4,8-Diliydroxy-16-(2-hydrox3anethyl-benzoxa2ol-5-yl)-7-propyl-5,5,9,13 -tetrametbyI-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9SJ3ZJ6S)-16-(2-Airdnomethyl-benzoxazol-5-yl)-4,8-diliydroxy-7-propyl-5,5,9,13-tetramethyl-oxacycloliexadec-l 3-ene-2,6-dione; (!S,3S,7S,;iOR,nS,12S,16R)-7,l l-Dihydroxy-10-propyl-8,8,12,16-tetpamethyl-3-(2-metfayl-berizoxazo]-5-yl)-4,17-dioxa-biclofl4.1.0]heptadecane-5,9-dione; (1 S,3S,7S, 1 OR, 11S, 12S,16R)-7,ll-Diliydroxy-3-(2-hydroxymethyl-beaizoxazol-5-yl)-l O-propyl-8,8,12,16-tetramethyl-4,l 7-dioxa-bicyclo [ 14.1.0]heptadecane-5,9-dione; (1 S,3S,7S, 1 OR, 11 S,12S, 16R)-3-(2-Aminometiiyl-benzoxazol-5-yl)-7,11-dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydraxy-7-butyl-5,5,9,13-tetramethyl-l 6-(2-methyI-benzoxazol-5-yl)-oxacyclob.exadec-13 -ene-2,6-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydra3cymethyl-benzoxazol-5-yl)-7-butyl-5,5,9,13-tetramethyl-oxacycloliexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S)- 16-(2-Aminomethyl-benzcoazol-5-yl)-4,8-dihydroxy-7-butyl-5,5,9,13 -tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10-hatyl-8,8,12,16-tetramethyl-3-{2-methyl-beiizoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]hqtadecane-5,9-dione; (1 S,3S,7S, 1 OR, 1 IS, 12S,16R)-7,1 l-Dihydroxy-3-(2-hydroxymethyl-benzoxazoI-5-yl)-l O-butyl-8,8,12,16-tetramefhyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (lS,3S,7S,10R,11S,2S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,ll-dihydroxy-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]lieptadecane-5,9 dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-anyl-5,5,9,13-tetramethyl-16-(2-methyI-ben2oxazoi-5-yl)-oxacycloiiexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Diliydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S39S43Z,16S)-16-(2-Aminome%l-beii2;oxazol-5-yl)-4,8-dihydroxy-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-l 3-ene-2,6-dione; (1 S,3S,7S, 1 OR, 11S, 12S,16R)-7,11-Dihydroxy-l O-allyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1 S,3S,7S, 1 OR, 11 S, 12S, 16R)-7,11 -Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yI)-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,n-dihydroxy-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[l 4.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacycIob.exadeG-13-ene-2,6-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-l 6-(2-hydroxymethyl-benzoxazol-5-yl)-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacycloIiexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S)-16-(2-Amiaoinethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclob.exadec-13-ene-2,6-diohe; (1S,3S,7S,10R,11S,12S,16R)-7,1 l-D2iydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-3-(2-meth.yl-benzoxazoI-5-yl)-4,17-dioxa-bicyclo[14.1.0]Iieptadecane-5,9-dione; (lS,3S,7S,10R,HS,12S,16R)-7,ll-Diliydroxy-3-(2-liydroxymethyl-benzoxazol-5-yl)-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1,0]heptadecane-5,,9-dione; (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,l ] -diiydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-D'ihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 13Z, 16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxa2ol~5-yl)-7-but-3 -ecnyI-5,5,9,13 -tetrametfayl-oxacyclohexadec-13-ene-2,6-dione; (4SJR,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-but-3-enyI-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (lS,3S,7S,10R,llS,12S,16R)-7,ll-Diliydroxy-10-but-3-enyi-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]b.eptadecane-5,9-dione; (1S,3S,7S,10R,11S,12S,16R)-7,1 l-Dihydroxy-3-(2-liydroxymethyl-bemoxazol-5-yl)-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dioce; (1 S,3S,7S, 1 OR, 11S,12S,16R)-3-(2-Ammomethyl-benzoxazol-5-yl)-7,11 -dib.ydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (4S,7R,8S,9S,13Z,16S)-4,8-Dih.ydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-6-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S, 132,16S)-4,8-Dihydroxy-16-(2-hydroxymethyI-benzoxazci-5-yl)-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dione; (4S,7R,8S,9S,13Z, 16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacycIohexadec-13-ene-2,6-dione; (lS,3S,7S,10R,llS,12S,16R)-7,ll-Dihydroxy-10-but-3-myI-8,8,12,I6-tetramethyl-3 -(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclof 14.1. OJheptadewnic-5,9-dione; (lS,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-but-3-inyl-8,8,12,16-tetrainethy]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dione; (1S,3S,7S,10R,1 lS,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,l 1-dihydroxy-10-but-3 -inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo [14.1.0]heptadecane-5,,9-dione, wherein the hydrogen atoms in the above-mentioned effector elements are replaced in the positions indicated in formula (T) by radicals Ll-L3. 4. Effector conjugate as claimed in any one of claims 1 to 3, wherein the linker is selected from the group that consists of the compounds of general formula (III), wherein V represents a bond or an aryl radical, o is zero, and T is an oxygen atom. 5. Effector conjugate as claimed in any one of claims 1 to 3, wherein the linker is selected from the group that consists of the compounds of general formula (III), wherein V represents a bond or an aryl radical or a group (Formula Removed) o is 0 to4,and Q is a bond or a group 6. Effector conjugate as claimed in claim 5, wherein V is a bond or a group (Formula Removed) is a bond or a group , o is 0, 2 or 3, s is 1, and T is an oxygen atom. 7. Effector conjugate as claimed in any one of claims 1 to 3, wherein the linker is selected from the group that consists of compounds of general formula (IV), wherein o is 0 to 4, and q is 0 to 3. 8. Effector conjugate as claimed in claim 7, wherein o is 0, 2 or 3, W1 is oxygen, qis 0, R22 is hydrogen, C1-C3 alkyl or aralkyl, R23 is hydrogen or C1-C3 alkyl, R24a is hydrogen or C1-C3 alkyl, R27 is fluorine, chlorine, CN, NO2, CO2R28 or OR28, R28 is hydrogen or C1-C5 alkyl, and U is oxygen, CHR22, or CHR22-NR23-C(=O)-.

Documents:

38-delnp-2005-abstract.pdf

38-delnp-2005-claims.pdf

38-delnp-2005-complete specification (as filed).pdf

38-delnp-2005-complete specification (granted).pdf

38-delnp-2005-correspondence-others.pdf

38-delnp-2005-correspondence-po.pdf

38-delnp-2005-description (complete).pdf

38-delnp-2005-form-1.pdf

38-delnp-2005-form-18.pdf

38-delnp-2005-form-2.pdf

38-delnp-2005-form-3.pdf

38-delnp-2005-form-5.pdf

38-delnp-2005-gpa.pdf

38-delnp-2005-pct-101.pdf

38-delnp-2005-pct-210.pdf

38-delnp-2005-pct-220.pdf

38-delnp-2005-pct-301.pdf

38-delnp-2005-pct-304.pdf

38-delnp-2005-pct-408.pdf

38-delnp-2005-pct-409.pdf

38-delnp-2005-pct-416.pdf

abstract.jpg