Title of Invention

PROTEIN PARTICIPATING IN RESTORATION FROM CYTOPLASMIC MALE STERILITY TO FERTILITY AND GENE ENCODING THE SAME

Abstract The present invention relates to a protein involved in restoration of a cytoplasmic male sterile individual to fertility which has 14 or more pentatricopeptide repeat (hereafter may be abbreviated to PPR) motifs, wherein a group of the motifs is divided into 3 or more blocks, each of the individual blocks has at least 2 or more PPR motifs, and the block in a carboxyl terminal (C terminal) side has 4 PPr motifs.
Full Text

DESCRIPTION Protein involved in restoration of cytoplasmic male sterility to fertility and gene encoding the protein and gene.
Technical Field
The present invention relates to a gene involved in restoration from cytoplasmic male sterility to fertility. More specifically, the present invention relates to the gene involved in restoration of cytoplasmic male sterility character (hereafter may be abbreviated to cms) used for developing a cultivar of a first filial hybrid (hereafter abbreviated to F1) , and a vector and a transformant containing the gene.
Background Art
As to crops such as cereal crops and vegetables, F1 cultivars are being actively developed with features such as 1) an agricultural genetic character improved excellently by heterosis, 2) an equal quality of harvests, and 3) protectability of a breeder's right on the basis of segregation of genetic characters in the next generation. Actually, F1 varieties of many major crops have gone into actual use.
A method for seed production of an F1 cultivar is exemplified by cms/Rf seed production system comprising a cytoplasmic male sterile (cms) line and a line (hereafter may be abbreviated to Rf) for restoration from male sterility of thecultivar. For example, the method has been developed for cereals such as rice. Sorghum, and corn and an oil crop such as sunflower. These method have been developed by using a technique of breeding or cell fusion.
For Brassicaceae, the system for F1 seed production by applying self-incompatibility is widely applied. For rapeseed showing unstable self-incompatibility, however, the system for F1 seed production requires use of the cms line and the Rf line.
On the contrary, in recent years, a study has been conducted for using cytoplasmic male sterile line (Kosena cms) derived

from Kosena radish and cytoplasmic male sterile line (Ogura cms) derived from Ogura radish for rapeseed. Both cms genes are encoded in a genome of mitochondria which is a cytoplasmic organelle, and their nucleotide sequences have been known. However, a molecular biological study using radish has not so developed and therefore, markers necessary for gene isolation have been seldom known. Thus, isolation of the gene from a nucleus is difficult. Therefore, introduction of the Rf gene has been achieved only for rapeseed by applying intergeneric crosses or cell fusion approaches to a radish line, of which fertility has been restored.
Furthermore, for Rf gene, 1 or more restorer genes are present according to each cms line of different plant species. For radish, the presence of Rfl gene and Rf2 gene is necessary for restoration of fertility. In addition, it has been known that Rfl gene reduces remarkably the accumulation of ORF 125 protein (M. Iwabuchi et al. , PlantMol. Biol. 39: 183-188. 1999) in mitochondria which is known as a cms-associated protein of radish (Jpn. J. Breeding 47 (separate volume 1) : p. 186. 1997 and Jpn. J. Breeding 48 (separate volume 1): p. 197. 199S.)
In rapeseed, it has been also known by gene analysis study that radish Rfl gene introduced by intrgeneric crosses or cell fusion reduces acu-uiTiU lation of ORF125 or ORF 138 protein (M. Grelon et al. , Mol. Gen. Genet. 243: 540-547,) which is known as the cms-associatedprotein, and that reductionof accumulation of these ORF 125 or ORF 138 protein coincides perfectly with fertility restoration phenomenon (N. Koizukaetal, Theor. Appl. Genet. 100: 949-955. 2000). The restoration of fertility of the male sterile line of rapeseed requires reduction of accumulation of the ORF 125 or ORF 138 protein. For this, Rfl gene is an important gene.
However, concerning a nucleotide sequence of Rf genes, only Rf2 gene, which is a restorer gene for a T-cytoplasm which is one of maize cms, was identified and isolated. But no nucleotide sequence of Rf genes of other plant species has been

known.
Disclosure of the Invention
It has been known that, the rapeseed restorer line in which Rfl gene derived from Ogura radish has been introduced by intergeneric hybridization or cell fusion, and the Fi cultivar created by using the line as a pollen parent, shows a higher content of glucosinolate (hereafter abbreviated to GSL) than the regulated value, thereby making a practical problem. This may be because the gene derived from radish which is involved in GSL biosynthesis is present around Rfl gene so as to make a tight genetic linkage and therefore the GSL content of the rapeseed restorer line (Rf line) increases. It has been known that GSL is contained in rapeseed expel and when given to an animal as a feed, it causes thyroid gland. Therefore, the GSL content of a rapeseed seed on a breeding stage is regulated to
18 //mole/ g or lower in North America and 20 A/mole/ g or lower in Europe.
Moreover, in recent years, a plant to which a function such as herbicide tolerance is added by gene recombination is being actively developed. For creating efficiently these plants, only the presence of the rapeseed restorer line yielded by breeding or cell fusion is insufficient, and isolation of Rf gene, particularly Rfl gene derived from radish, has been desired.
Thus, a problem to be solved by the present invention is to isolate Rf gene, particularly Rfl gene derived from radish, and identify its structure. A further problem to be solved by the present invention is to provide a means for establishing the rapeseed restorer line by using the Rf gene isolated.
As the result of the intensive study on solving the above problems, the present inventors successfully achieved the cloning of Rfl genes derived from rapeseed and radish, thereby solving the problems.
Thus, the present invention provides a protein involved

in restoration from sterility of a cytoplasmic male sterile individual to fertility which has 14 or more pentatricopeptide repeat (hereafter may be abbreviated to PPR) motifs, wherein a group of the motifs is divided into 3 or more blocks, each of the individual blocks has at least 2 or more PPR motifs, and the block in a carboxyl terminal (C terminal) side has 4 PPR motifs.
Preferred embodiments of an above protein provide;
the protein wherein the number of PPR motifs is 14 to 16;
the protein wherein the PPR motif group is divided into 3 blocks and each block has 5,7, and 4 PPR motifs in the order from an amino terminal (N terminal);
the protein wherein the fourth amino acid located in a second PPR motif from the amino terminal (N terminal) is an amino acid other than serine, threonin and cysteine;
the protein wherein the fourth amino acid located in a second PPR motif from the amino terminal (N terminal) is any one of asparagine, glutamine, aspartic acid, glutamic acid or histidine; and
the protein which futher has a signal peptide sequence to translocate to a mitochondrion at the amino terminal or has a sequence of -LysAspGluLeu- at the carboxyl terminal.
Another aspect of the present invention provides a protein involved in restoration of the cytoplasmic male sterile individual to fertility, which causes gel shift of a transcriptional product after contacting to the transcriptional product of a cytoplasmic male sterile gene.
A still another aspect of the present invention provides:
a protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence of SEQ ID NO.26;
a protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence of SEQ ID NO.27;
a protein involved in restoration of the cytoplasmic male

sterile individual to fertility, which has an amino acid sequence of SEQ ID NO.28; and
a protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence of SEQ ID NO.29.
A still another aspect of the present invention provides any of the following proteins:
(1) a protein having a sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 17, or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/ or substituted, in the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of the amino acid sequence of SEQ ID NO. 17 , or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO. 19, and is involved in restoration of the cytoplasmic male sterile individual to fertility.
A still another aspect of the present invention provides any of the following proteins:
(1) a protein having an amino acid sequence of SEQ ID NO. 3, SEQ ID. 17, or SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/or substituted, in the amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17, or SEQ ID NO. 19, and is involved in restoration of the cytoplasmic male sterile individual to fertility.
Preferably in the present invention, the cytoplasmic male sterile individual has a cytoplasmic male sterile gene of Kosena radish and/ or Ogura radish or a homologue thereof.
A still another aspect of the present invention provides a DNA encoding any one of proteins of the present invention described above.

A still another aspect of the present invention provides: a DNA having a nucleotide sequence of SEQ ID NO. 22; a DNA having a nucleotide sequence of SEQ ID N0.23; a DNA having a nucleotide sequence of SEQ ID NO.24; and a DNA having a nucleotide sequence of SEQ ID NO.25. A still another aspect of the present invention provides any of the following DNAs:
(1) a DNA having a nucleotide sequence of SEQ ID NO.2, SEQ ID
NO.16, or SEQ ID NO.18; or
(2) a DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/ or substituted, in the nucleotide sequence of SEQ ID NO. 2, SEQ ID NO.16, or SEQ ID NO. 18, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) a DNA which hybridizes with a DNA having a nucleotide sequence of SEQ ID NO. 2, SEQ ID NO. 16, and SEQ ID NO. 18 under a stringent condition and is involved in restoration of the cytoplasmic male sterile individual to fertility.
A still another aspect of the present invention provides any of the following DNAs:
(1) a DNA having a sequence from 3754th to 8553th nucleotides of the nucleotide sequence of SEQ ID NO. 1 or a sequence from 812th to 3002th nucleotides of the nucleotide sequence of SEQ ID NO.15; or
(2) a DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotide are deleted, added, and/ or substituted, in the sequence from 3754th to 8553th nucleotides of the nucleotide sequence of SEQ ID NO.l, or a sequence from 812th to 3002th nucleotides of the nucleotide sequence of SEQ ID NO. 15, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) a DNA which hybridizes with a DNA having a sequence from
3754th to 8553th nucleotides of the nucleotide sequence of SEQ
ID NO. 1 or a sequence from 812th to 3002th nucleotides of the
nucleotide sequence of SEQ ID NO. 15 under a stringent condition,

and is involved in restoration of the cytoplasmic male sterile individual to fertility.
A still another aspect of the present invention provides any of the following DNAs:
(1) a DNA having a nucleotide sequences of SEQ ID NO.l or 15;
or
(2) a DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/ or substituted in the nucleotide sequence of SEQ ID NO. 1 or SEQ ID NO. 15, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) a DNA which hybridizes with a DNA having a nucleotide sequence of SEQ ID NO.l or SEQ ID NO. 15 under a stringent condition, and is involved in restoration of the cytoplasmic male sterile individual to fertility.
Preferably in the present invention, the cytoplasmic male sterile individual has a cytoplasmic male sterile gene of Kosena radish and/ or Ogura radish or a homologue thereof.
A still another aspect of the present invention provides a vector containing DNA of the present invention.
A still another aspect of the present invention provides a transformant having DNA of the present invention or vector of the present invention. The transformant is preferably a transformed plant.
A still another aspect of the present invention provides a method for the restoration of the cytoplasmic male sterile individual to fertility wherein DNA of the present invention is used.
A still another aspect of the present invention provides a transformant having a cytoplasmic male sterile gene wherein a partial or full length of DNA of the present invention is introduced with an induction type promoter to a cell having DNA of the present invention, so that the transformant can regulate an expression of the cytoplasmic male sterile gene.
A still another aspect of the present invention provides

a method for maintaining the cytoplasmic male sterile line by using the transformant described above.
A still another aspect of the present invention provides a method for detecting a gene involved in restoration from the cytoplasmic male sterile, wherein 15 to 50mer oligonucleotide primer freely designed from the above DNA of the present invention or probe of at least 15 mer consisting of all or a part of the above DNA of the present invention is used, and the quantity of the nucleotide sequence amplif iedby the primer or the quantity of the nucleotide sequence detected by the probe in an organism sample of interest is confirmed to be 1 gene or more in 1 genome.
A still another aspect of the present invention provides a promoter DNA having a sequence from 3754th to 5091th nucleotides of a nucleotide sequence of SEQ ID NO.l or a sequence from 1st to 811th nucleotides of a nucleotide sequence of SEQ ID NO.15.
Brief Description of the Drawings
Fig. 1 shows a genetic map of Rf marker.
Fig. 2 shows diagrammatic view of a structure of a lambda clone CHI carrying the nucleotide sequence of SEQ ID NO.l.
Fig. 3 shows a result of detection of a DNA introduced into transformant by using PCR method:
Lane 1: control vector; lane 2 : transformed rapeseed; lane 3: cytoplasmic male sterile rapeseed,
a: 3186 bp to 3753 bp, length: 568 bp,
b: 4869 bp to 5112 bp, length: 244 bp,
c: 7766 bp to 8250 bp, length: 485 bp.
Fig. 4 shows a result of Western Blotting analysis of reduction of accumulation of ORF125 which is a CMS protein in the transformant:
Lane 1: cytoplasmic male sterile rapeseed -1- 15 μg;
Lane 2: fertility restored rapeseed 15 μg;
Lane 3: cytoplasmic male sterile rapeseed -2- 15 μg;
Lane 4 to 7: cytoplasmic male sterile rapeseed -2-,
Dilution series :15/2 μg, 15/4 μg, 15/8 μg, and 15/16 μg;

Lane 8: transformed rapeseed 15 μg;
Fig. 5 shows a result of microscopic observation of an pollen grains taken from a flowered plant of transformed rapeseed.
Fig. 6 shows the nucleotide sequence of pSTV125-5' #LA6 and pSTV125-5' #LA12.
The Best Mode for Carrying Out the Invention
Embodiments of the present invention will be described below in detail.
(1) Embodiments of the protein of the present invention
The protein of the present invention relates to any of proteins of (i) to (v) below:
(i) a protein involved in restoration of a cytoplasmic male sterile individual to fertility which has 14 or more pentatricopeptide repeat (hereafter may be abbreviated to PPR) motifs, wherein a group of the motifs is divided into 3 or more blocks, each of the individual blocks has at least 2 or more PPR motifs, and the block in a carboxyl terminal (C terminal) side has 4 PPR motifs.
(ii) a protein involved in restoration of the cytoplasmic male sterile individual to fertility, which causes gel shift of a transcription product after contacting to the transcription product of a cytoplasmic male sterile gene.
(iii) a protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence of any of SEQ ID NOS. 26 to 29;
(iv) a protein of any of the followings:
(1) a protein having a sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 17, or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or aplurality of amino acids are deleted, added, and/or substituted.

in the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of the amino acid sequence of SEQ ID NO. 17, or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO. 19, and is involved in restoration of the cytoplasmic male sterile individual to fertility; and (v) a protein of any of the followings:
(1) a protein having an amino acid sequence of SEQ ID NO. 3, SEQ ID. 17, or SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/ or substituted, in the amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17, or SEQ ID NO. 19, and is involved in restoration of the cytoplasmic male sterile individual to fertility.
In the present specification, the PPR motif is the '^pentatricopeptide repeat" motif. This PPR motif is a motif structure of a novel protein found in the course of an Arabidopsis genome project. The base motif thereof is that a sequence of 35 degenerated amino acids is repeated in tandem on a primary structure of the protein. The PPR motif has the sequence represented by amino terminal (N terminal) "VTYNTLISGYCKNGKLEEALELFEEMKEKGIKPDV" -carboxyl terminal (C terminal) as a consensus amino acid sequence. This motif is the proposed by Small and Peeters (reference: Trends Biochem. Sci. 2000, 25 46-47). In the year of the publication of the reference, about 200 genes capable of having this motif in the Arabidopsis genome were registered to a gene bank such as GenBank (http://www.ncbi.nlm.nih.gov/GenBank/index.html.) At present, possibility of presence of this motif structure in a certain protein can be easily determined by a program stored in Protein Families Database of Alignments and HMNs (hereafter abbreviated to Pfam;
http://www.Sanger.ac.uk/Software/Pfam/search.shtml) located in Sanger Institute, U.K.
Up to now, there are following examples of proteins having

the PPR motif of which function has been known: 1) Yeast PET309 and Neurospora crassa CYA-5 which are proteins translocating to mitochondria, interacts with coxl mRNA which is a mitochondrial gene to regulate coxl expression at a level of post-transcriptional processing or translation (Manthey and McEwen EMBO J 1995 14 4031, Coffin et al. Curr Genet 1997 32 273-280); and 2) Maize CRPl which is a PPR motif protein translocating to mitochondrion, is essential for translation of petA andpetD gene which is a chloroplast gene and also essential for a processing step of petD mRNA (Fisk et al, EMBO J 1999 18 2621-2630) Hence, the proteins having the PPR motif may highly probably contribute to translation regulation in some manner.
At this time, the inventors have isolated a gene involved in restoration of a cytoplasmic male sterile individual of Kosena radish to fertility, and have found that the protein encoded thereby has 14 or more pentatricopeptide repeat (hereafter abbreviated to PPR) motifs, the PPR motif group is divided into 3 or more blocks, each of the individual blocks has at least 2 or more PPR motifs, and the block located in a position nearest to the carboxyl terminal (C terminal) has 4 PPR motifs.
The above mentioned protein involved in restoration of a cytoplasmic male sterile individual to fertility is preferably one wherein the number of PPR motifs is 14 to 16, and more preferably one wherein the PPR motif group is divided into 3 blocks and each block has 5, 7, and 4 PPR motifs in the order from an amino terminal (N terminal).
Specifically, the protein comprises:
(1) PPR cluster #1: the PPR cluster in which the first to fifth PPR motifs from the N terminal comprises consecutive 175 residues;
(2) PPR cluster #2: the PPR cluster in which the sixth to 12th PPR motifs from the N terminal comprises consecutive 245 residues;
(3) PPR cluster #3: the PPR cluster in which the 13th to 16th PPR motifs from the N terminal comprises consecutive 140

residues.
More preferably, the fourth amino acid, which is present in the second PPR motif from the amino terminal (N terminal) side, is an amino acid other than serine , threonine, or cysteine . More preferably, the fourth amino acid, which is present in the second PPR motif from the amino terminal (N terminal) side, is any of asparagine, glutamine, aspartic acid, glutamic acid, or histidine. Particularly preferably, the fourth amino acid, which is present in the second PPR motif from the amino terminal
(N terminal) side, is asparagine.
It has been known that normally, fertility restorer gene is present in a nuclear genome and the cytoplasmic male sterile gene is present in the mitochondria. Therefore, the above protein involved in restoration of the cytoplasmic male sterile individual to fertility preferably further has a signal peptide sequence for the translocation to the mitochondrion in the amino terminal or has a sequence of Lys-Asp-Glu-Leu in the carboxyl terminal.
The signal peptide sequence at the N terminal for the translocation to the mitochondra is exemplified by those confirmed by a prediction program "TargetP"
(http://www.cbs.dtu.dk/services/TargetP/) or the predicion program "^Psort" (http: //psort. nibb .ac.jp/) based on an algorithmof 0. Emanuelsson (J. Mol. Biol. 300, 1005-1016. 2000) . Example of the signal peptide include the signal peptide
(MetAlaPheArgGlnThrLeuSerlleArgSerArgLeuPheAlaArgArgAsnGlnP roValTyrHisIlelleProArgGluSerAspHisGluArgAsp) of AtOXAl gene
of Arabidopsis thaliana (W. Sakamoto et al. : Plant Cell Physiol. 41: 1157-1163.) Among these peptides, a preferable amino acid sequence is exemplified by the sequence of 1st to 79th amino acids in the amino acid sequence of SEQ ID NO. 3 , and particularly preferably, the sequence of 1st to 34th amino acids in the amino acid sequence of SEQ ID NO.3.
The protein according to the present invention which is involved in restoration of the cytoplasmic male sterile

individual to fertility is bound to the transcription product of the cytoplasmic male sterile gene so as to cause an inhibition of translation of the cytoplasmic male sterile gene, thereby achieving restoration of the cytoplasmicmale sterile individual to fertility.
Examples of the transcriptional product of the cytoplasmic male sterile gene include the transcriptional product (mRNA) of each gene of ORF125 which is a causal protein causing Kosena cytoplasmic male sterilityor ORF138 which is the causal protein causing Ogura cytoplasmic male sterility. Preferred examples include 5'-UTR (Bonhomme et al. ; Mol. Gen. Genet. 235: 340-348. 1992) region of the gene.
Examples of the methods for confirming the binding to the transcriptional product of the cytoplasmic male sterile gene include a method in which the protein according to the present invention is added to mRNA of orfl25 or orfl38 which was artificially transcribed in vitro, followed by electrophoresis, so-called gel shift method. Practical operation may be carried out under a condition commonly applied as the gel shift method.
Another method is that a fused gene of ORF125 or ORF138
gene and a detectable reporter gene such as β-galactosidase or luciferase is expressed in Escherichia coli or the like, the protein of the present invention is added thereto, and the presence or absence of expression inhibition is observed.
Specifically , the fertility restorer gene of the nucleotide sequence of the SEQ ID NO. 2 is integrated in a vector for expression in a Escherichia coli , and a vector wherein 5 '-UTR region and a coding region of 25 amino acids of orfl25 are fused to lacZ gene is integrated in the Escherichia coli . These vectors are subjected to induction expression, expression of lacZ gene is suppressed only in the case where the expression vector in which the fertility restorer gene has been integrated is present, and thereby blue colonies of Escherichia coli becomes white in the presence of X-Gal. As described above, it can be confirmed that, by using a gene encoding the protein of the present

application and perform among the above-mentioned confirmation, the protein of the present invention has a function to restore the cytoplasmic male sterile individual from sterility to fertility by causing translation inhibition of the cytoplasmic male sterile gene.
The most preferable examples of the proteins of the present invention which are involved in restoration of the cytoplasmic male sterile individual to fertility, include proteins having an amino acid sequences having homology of 70% or higher, preferably 80% or higher, more preferably 90% or higher, and further preferably 92% or higher, still further preferably 95% or higher, particularly 97% or higher to the amino acid sequence of SEQ ID NOS. 26 to 29 which is the consensus sequence. The consensus sequence is exemplified by the amino acid sequence of SEQ ID NO. 26, preferably exemplified by the amino acid sequence of SEQ ID NO,27 or 28, and particularly preferably exemplified by the amino acid sequence of SEQ ID NO. 29.
Preferable examples of the above mentioned proteins include:
(1) a protein having a sequence from 50th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 17, or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/or substituted, in the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of the amino acid sequence of SEQ ID NO. 17, or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO. 19 , and is involved in restoration of the cytoplasmic male sterile individual to fertility.
The examples of the proteins having a sequence for the translocation to mitochondria includes: (1) a protein having an amino acid sequence of SEQ ID NO. 3, SEQ

ID. 17, or SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/or substituted, in the amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17, or SEQ ID NO. 19, and is involved in restoration of the cytoplasmic male sterile individual to fertility.
The protein according to the present invention is the protein which can be involved in restoration of the cytoplasmic male sterile individual to fertility. More specifically, when the transformant plant (Rf line) to which DNA encoding the protein of the present invention has been introduced is crossed with an individual of the cytoplasmic male sterile line (cms line) , Fiseeds of which fertility have been restored can be obtained. Preferable examples of the above cms line individual include the plant to which the cytoplasmic male sterile gene of Kosena radish and/or Ogura radish has been introduced.
The protein of the present invention can be isolated by screening by using the gel shift method as described above, and can be isolated or synthesized by using DNA of the present invention described later. Method for obtaining the protein of the present invention is described bellow.
(2) Embodiments of DNA of the present invention
The DNA of the present invention relates to DNA of any of the following (I) to (iv).
(i) DNA encoding the protein of the present invention described above;
(ii) DNA having a nucleotide sequence of any of SEQ ID NO. 22 to SEQ ID N0.25;
(iii) DNA of any of the followings;
(1) DNA having a nucleotide sequence of SEQ ID NO. 2, SEQ ID NO. 16, or SEQ ID NO.18; or
(2) DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/or substituted, in the nucleotide sequence of SEQ ID NO. 2, SEQ ID NO. 16, or SEQ ID NO. 18,

and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) a DNAwhich hybridizes with a DNAhavinga nucleotide sequence of SEQ ID NO. 2, SEQ ID NO. 16, and SEQ ID NO. 18 under a stringent condition and is involved in restoration of the cytoplasmic male sterile individual to fertility. (iv) DNA of any of the followings:
(1) DNA having a sequence from 3754th to 8553th nucleotides of the nucleotide sequence of SEQ ID NO. 1 or a sequence from 812th to 3002th nucleotides of the nucleotide sequence of SEQ ID NO.15; or
(2) DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotide are deleted, added, and/or substituted, in the sequence from 3754th to 8553th nucleotides of the nucleotide sequence of SEQ ID NO.l, or a sequence from 812th to 3002th nucleotides of the nucleotide sequence of SEQ ID NO. 15, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) DNA which hybridizes with a DNA having a sequence from 3754th to 8553th nucleotides of the nucleotide sequence of SEQ ID NO.l or a sequence from 812th to 3002th nucleotides of the nucleotide sequence of SEQ ID NO.15 under a stringent condition, and is involved in restoration of the cytoplasmic male sterile individual to fertility.
(v) DNA of any of the followings:
(1) DNA having a nucleotide sequences of SEQ ID NO.l or 15; or
(2) DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/ or substituted in the nucleotide sequence of SEQ ID NO. 1 or SEQ ID NO. 15, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) DNA which hybridizes with a DNA having a nucleotide sequence of SEQ ID NO.l or SEQ ID NO. 15 under a stringent condition, and is involved in restoration of the cytoplasmic male sterile individual to fertility.

In this specification, the DNA of the present invention may also be referred to as the gene of the present invention.
The nucleotide sequence of SEQ ID NO. 1 is a genomic DNA nucleotide sequence of 8553 nucleotides , the nucleotide sequence of SEQ ID NO. 2 is a coding sequence obtained from SEQ ID NO.l, and the nucleotide sequence of SEQ ID NO. 3 is an amino acid sequence which is encoded by the nucleotide sequence of SEQ ID NO.2.
The nucleotide sequence of SEQ ID NO. 15 is a genomic DNA nucleotide sequence of 3306 bases, the nucleotide sequence of SEQ ID NO. 16 is a coding sequence obtained from SEQ ID NO. 15, and the nucleotide sequence of SEQ ID NO. 17 is an amino acid sequence which is encoded by the nucleotide sequence of SEQ ID NO.16.
The expression "the nucleotide sequence in which 1 or a plurality of nucleotides are deleted, added, and/or substituted" in this specification means the nucleotide sequence in which any number, fow example from 1 to 20, preferably from 1 to 15, more preferably from 1 to 10, and further preferably from 1 to 5 of nucleotides are deleted, added, and/or substituted.
The expression ""the amino acid sequence in which 1 or a plurality of amino acids are deleted, added, and/or substituted" in this specification means the amino acid sequence in which any nijmber, for example from 1 to 20, preferably from 1 to 15, more preferably from 1 to 10, and further preferably from 1 to 5 of amino acids are deleted, added, and/ or substituted.
The expression ""DNA which hybridizes under a stringent condition" means the nucleotide sequence of DNA which is obtained using the DNA as a probe by colony hybridization method, plaque hybridization method, or Southern blot hybridization method. Example of such DNA is one which can be identified by using a filter prepared by fixing DNA or DNA fragment derived from a
colony or a plaque, and performing hybridization at 65 °C in the presence of 0 .7 to^l. 0 M NaCl followed by washing the filter using 0.1 to 2 x SSC solution (1 x SSC is composed of 150 mM sodium chloride and 15 mM sodium citrate) at 65 "C.

Hybridization can be carried out according to the method described in Molecular Cloning: A Laboratory Manual, 2nd Ed. , Cold Spring Harbor Laboratory, Cold Spring Harbor, NY., 1989 (hereafter abbreviated to "Molecular Cloning 2nd Ed").
The DNA which hybridizes under a stringent condition is exemplified by the DNA having a certain or higher degree of homology to the nucleotide sequence of the DNA used as the probe. The term "a certain or higher degree of the homology" used herein is, for example, 70% or higher, preferably 80% or higher, more preferably 90% or higher, further preferably 93% or higher, particularly preferably 95% or higher, and most preferably 97% or higher. The DNA having a certain or higher degree of the homology used herein includes both of a polynucleotide showing homology as described above and the polynucleotide of a complementary strand thereof.
The DNA of present invention is DNA which can be involved in restoration of the cytoplasmic male sterile individual to fertility. More specifically, when the transformant plant (Rf line) to which DNA of the present invention has been introduced is crossed with the individual of the cytoplasmic male sterile line (cms line) , Fl seed of which fertility has been restored can be obtained. Preferred examples of the aforementioned cms line individual include an individual to which the cytoplasmic male sterile gene of Kosena radish and/or Ogura radish has been introduced.
(3) Method for obtaining DNA of the present invention
A method for obtaining DNA of the present invention is not particularly limited. On the basis of information of the nucleotide sequence of SEQ ID NO.l or SEQ ID NO.2 disclosed in the present specification, and the amino acid sequence of SEQ ID NO. 3 or the PPR motif obtained based on the information of the amino acid sequence of SEQ ID NO. 3 , and the amino acid sequence obtained by combining a mitochondrial transit sequence, DNA of the present invention can be isolated or synthesized by applying

a common breeding technique and a common genetic engineering technique which are known to those skilled in the art.
Specifically, DNA of the present invention can be obtained from an appropriate plant origin in which the gene of the present invention is expressed, specifically a Raphanus plant including a cultivar and a relative species of radish, or other plants to which the genomic DNA containing the restorer gene is introduced from these plants by crossing or cell fusion techniques, more specifically Raphanus plants such as Kosena radish, Ogura radish, Yuanhong radish or cultivars derived from those radishes and relative species of these radish cultivars or Brassica plants to which the genomic DNA containing the cytoplasmic male sterility restorer gene of these plant species and cultivars is introduced from these plants by crossing or cell fusion techniques. The gene of the present invention can be isolated and obtained, for example, by isolating DNA markers locating around an Rf gene, preparing a genome map indicating a relationship between genetic distances of these DNA markers and the Rf gene, and applying positional cloning method (also called chromosome walking) of an Rf region while starting from the genome map.
This technique is started from finding an appropriate DNA marker on a genomic DNA and preparing the genome map by measuring the genetic distance of the Rf gene and the DNA markers. For the DNA markers which generally has some lOObp length, the genome derived from a father should be distinguished from the genome derived from a mother. The DNA marker should localize a same chromosome as that of the gene, and markers of which a mode of inheritance is almost same as that of the gene due to a small distance from the gene, that is, a marker having a genetically tight linkage, is more desirable.
As method for isolating the DNA marker, RFLP method has been frequently used so far, however, simple and convenient methods such as RAPD method and AFLP (Amplified Fragment Length Polymorphism) method which use PCR, are recently used (Nucleic

Acids Research, 1995, Vol. 23, NO. 21: 4 407-4414) . Particularly, AFLP method is effective means for obtaining the marker having the genetically tight linkage. As a material for measuring the genetic distance from the marker, there is normally used an F2 population obtained by self pollination of an F] generation produced by crossing a recessive homozygous individual lacking the Rfl gene with a dominant homozygous individual having homozygous Rfl genes, and BCi population obtained by crossing the Fi generation with the recessive homozygous plant, which is the parent thereof, lacking a gene of interest.
As the recessive homozygous individual as described above, the Raphanus plants including the cultivar and the relative species of radish of the cytoplasmic male sterile line, more specifically Kosena radish and Ogura radish of the cytoplasmic male sterile line, or Brassica plants to which the cytoplasmic male sterility derived from Kosena radish (Kosena cms) and the cytoplasmic male sterility derived from Ogura radish (Ogura cms) have beenintroduced, more specifically cms rapeseed can be used.
As the dominant homozygous plant described above, the Raphanus plants including the cultivar and the relative species of radish of the Rf line, more specifically Brassica plants, to which the genomic DNA containing the cytoplasmic male fertility restoration gene of Raphanus plants including Kosena radish, Ogura radish, Yuanhong radish or cultivars and relative species of these radish clutivars, which are the cytoplasmic male sterile line, has been introduced by crossing or cell fusion techniques, more specifically Rf rapeseed can be used.
For analysis of the F2 population obtained by self pollination of the Fi generation obtained by crossing of these parents and the BCi population obtained by crossing the F: generation with the recessive homozygous plant, normally 100 individuals or more and more preferably 1000 individuals or more are desirably used. The number of the individuals used as many as possible make accuracy of the genome map higher and a physical distance from the DNA marker to a gene of interest becomes short.

Similarly in case of the Rf gene, the DNA marker having a shorter physical distance can be obtained.
As the material for the measurement of the genetic distance of the DNA marker from the Rf gene, for example, there can be used F2 population of some thousand individuals which is obtained by self pollination of the radish Fi generation produced by crossing of Kosena radish {Raphanus sativus cv. Kosena) of the cms line with Yuanhong radish (Raphanus sativus cv. Yuanhong) of the Rf line according to the method described in N. Koizuka et al. (Teor. Appl. Genet. 100: 949-955, 2000). Analysis of these populations allows isolation of the DNA markers with a linkage in a form sandwiching the Rf gene and located in a position with a distance of about 0.2 cM from both sides thereof. By this step, the genome map as shown in Fig. 1, which shows the genetic distance of the marker from the Rf gene can be prepared.
Subsequent to preparation of the genome map, the genomic DNA which corresponds to its position should be cloned to combine between DNA markers sandwiching the objective gene. Normally, the physical distance between DNA markers and the objective gene is large and hence, combination of a plurality of clones having genomic DNA fragments allows covering a region from the DNA marker to the objective gene. A step to combine these DNA markers by using the clone having genomic DNA fragments is preparation of contig. For the Rf gene, contig can be similarly prepared by combining these DNA markers which is located in the position nearer the Rf gene by using a plurality of clones having genomic DNA fragments, so as to cover "the Rf gene region.
A collection of clones having genomic DNA fragments can be obtainedby preparing a genomic library. Normally, some kinds of vectors are used according to the length of the genomic DNA which can be cloned. Examples include those constructed by using a lambda phage vector which can clone a fragment having the length up to about 20 kb, a cosmid vector which can clone a fragment having a relatively long (up to 40 kb) length, a BAC (Bacterial Artificial Chromosome) vector which can clone a fragment having

a longer (100 or more kb) length.
In any of libraries , it is important that a value produced bymultiplyinga number of populations of the library to an average length of the fragment cloned becomes the value 4 to 5 times a full length (genome size) of the genome supplied to the library. The genome size of radish may be about 500 Mbp and therefore, in case of the lambda phage vector having the average length of 20 kb, the number of population becomes 1.0 x 105 to 1.25 X 105 and in case of the cosmid library having the average length of 40 kb, the number of population becomes 5.0 x 104 to 6,25 X lO4. The genome size of rapeseed is thought to be about 1000 Mbp and therefore, in case of the lambda phage vector having the average length of 20 kb, the number of population becomes 2.0 X 10^ to 2 . 5 X 10^, and in case of the cosmid library having the average length of 4 0 kb, the number of population becomes 1.0 X 10 to 1.25 X 10
For the genomic DNA supplied to the library, the genomic DNA may be extracted from a living organism containing the objective gene by an ordinary method. In case of the Rf gene, there can be used the Raphanus plant including the cultivar and the relative species of radish of the Rf line, more specifically Brassica plants, to which the genomic DNA containing the cytoplasmic male fertility restorer gene of Raphanus plants including Kosena radish, Ogura radish, Yuanhong radish or varieties and relative species of these radish varieties, which are the cytoplasmic male sterile line, has been introduced by crossing or cell fusion techniques , more specif icallyK/rapeseed. Generally, it may be most preferable to extract the genomic DNA from the same Rf line plant as the parent plant used for preparation of the F2 population and the BCi population so as to prepare the genomic library. The genomic DNA can be prepared according to such ordinary method as CTAB method (Murray, M. G. and Thompson, W. F. (1980) Nucleic Acids Res. 8: 4321)
For the preparation of contig, the clone having DNA marker which is located in both sides of the Rf gene is first isolated.

Isolation is carried out from the genomic library by the ordinary method using plaque hybridization method in case of a lambda phage library and by using colony hybridization method in case of cosmid library and BAC library. Next, using a terminal region of the clone isolated as an index, contig is prepared by isolating the clone located in an adjacent position of the clone. After preparation, the nucleotide sequence of the contig is determined by the ordinary method.
From the development of a genome project in recent years, a technique for presuming a functional gene on the basis of the nucleotide sequence of the genomic DNA has been advanced. A gene discovery program represented by "Genscan" can presume the gene in a considerable probability. In addition, a homology search program represented by 'BLAST" can presume similarity to other genes and proteins. Using these analytical programs, presumption and isolation of the objective gene are carried out. In the case of Rf gene, similarly, the genomic DNA sequence of the contig can be isolated and identified by using a similar analytical software. Such analysis reveals a promoter region on a genomic DNA nucleotide sequence, a structural gene region containing an intron, and a terminator region. Also, concerning the structural gene containing the intron, the gene in a form which is translated into a protein from which the intron has been excluded and the amino acid sequence corresponding to the gene are clearly indicated. In such manner, the Rf gene on the contig can be presumed in a considerable probability.
Moreover, on the basis of the gene sequence presumed by using the analytical programs as described above, the actual form of in vivo expression of the obj ective genome can be confirmed by purifying an mRNA and isolating complementary DNA (cDNA) corresponding thereto. A starting site of transcription is conveniently confirmed by analysis applying easy 5 ' -RACE method employing PCR and more reliably, primer extension method and SI mapping method.
The methods mentioned above have been described in

Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY. 1989 and the like.
The genes of the present invention which was isolated on the basis of the nucleotide sequence presumed by the techniques as described above are exemplified by DNA of SEQ ID NO. 2, SEQ ID NO. 16, and SEQ ID NO. 18. Thus, on the basis of the DNA sequence, cDNA can be easily isolated from other plant origin by common genetic engineering technique.
Specifically, the cDNA corresponding to the gene of the present invention can be obtained from the appropriate plant origin in which the gene of the present invention is expressed, specifically the Raphanus plant including the cultivar and the relative species of radish or other plants, to which the genomic DNA containing the cytoplasmic male sterile restorer gene is introduced from these plants by crossing or cell fusion techniques, andmore specifically Raphanus plants such as Kosena radish, Ogura radish, and Yuanhong radish or cultivars and relative species of these radish cultivars or Brassica plants, to which the genomic DNA containing the cytoplasmic male fertility restorer gene of these plant species and cultivars is introduced by crossingor cell fusion techniques , by preparing a cDNA library according to the ordinary method and selecting a desired clone from the library by using the appropriate DNA fragment specific to the gene of the present invention as the probe or by using an antibody against a translation product of the gene of the present invention.
In the above described procedure, an origin of the cDNA is exemplified by various cells and tissues which express the gene of the present invention and a cultured cell derived therefrom. Separation of total RNA, separation and purification of mRNA, and obtaining and cloning of cDNA from these cells and tissues can be carried out according to the ordinary method.
The method for screening the gene of the present invention from the cDNA library is not particularly limited, and can follow

the ordinary method.
As the probe used herein, the DNA chemically synthesized on the basis of information concerning the nucleotide sequence of the gene of the present invention can be generally used, and the gene of the present invention and the fragment thereof already obtained can be preferably used. Moreover, a sense primer and an antisense primer, which have been designed on the basis of information of the nucleotide sequence of the gene of the present invention, can be also used as the probe for screening.
A nucleotide sequence of the sense primer and the antisense primer used as the above probe is a partial nucleotide sequence corresponding to the DNA which encodes the amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17, or SEQ ID NO. 19, which has at least 15 to 50 consecutive nucleotides and preferably 20 to 30 consecutive nucleotides. Alternatively, a positive clone itself having the sequence as described above can be used as the probe.
Obtaining the gene of the present invention may be carried out in combination of techniques ordinary used for isolation of the gene, such as DNA and RNA amplification technique by PCR method and the RACE method represented by 5'-RACE method.
The primer used for application of PCR method can be appropriately designed on the basis of information of the nucleotide sequence of the gene of the present invention which was revealed by the present invention, and can be synthesized by the ordinary method- Isolation and purification of the amplified DNA and RNA fragments can be carried out by the ordinary method as described above. For example, gel electrophoresis can be employed.
As for the gene or various DNA fragments of the present invention obtained by the above described procedures, the nucleotide sequence thereof can be determined according to the ordinary method.
By using partial or all nucleotide sequence of the gene of the present invention obtained by such procedure, the presence

of the gene of the present invention and the occurrence of expression thereof in an individual or various tissues can be characteristically detected.
As described above, the gene of the present invention is exemplified by DNA encoding an amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17, or SEQ ID NO. 19, but is not limited thereto. Homologues of the gene are included in the present invention.
The homologues of the gene means a series of related genes which have a sequence homology with the gene (or a gene product thereof) of the present invention and are recognized as a gene family on the basis of a similarity of a structural feature as described above and a biological function thereof as described above. An allele of these gene is included.
For example, the gene of the present invention is not limited to the gene having a specific nucleotide sequence of SEQ ID NO.l or SEQ ID NO. 2, but can have the nucleotide sequence selected by combining optionally a codon corresponding to an individual amino acid residue shown by SEQ ID NO.3. Similarly, the gene can have not only a specific nucleotide sequence of SEQ ID NO. 15 or SEQ ID NO. 16, but also can have the nucleotide sequence selected by combining with an optional codon corresponding to individual amino acid residues shown by SEQ ID NO.17. The gene can have not only a specific nucleotide sequence of SEQ ID NO. 18 , but also can have the nucleotide sequence selected by combining with an optional codon corresponding to individual amino acid residues shown by SEQ ID NO. 19 . Selection of the codon can be carried out according to the ordinary method and for example, a frequency of codon use in a host used can be taken into account.
Further, as described above, the gene of the present invention includes DNA which hybridizes with DNA having a nucleotide sequence of SEQ ID NO.l, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 16, SEQ ID NO. 18, or a part thereof under a stringent condition. Such DNA are DNA having a certain or higher degree of homology with DNA having the nucleotide sequence of SEQ ID

NO.l, SEQ ID NO.2, SEQ ID NO,15, SEQ ID NO.16, SEQ ID NO.18, or a part thereof.
The above described DNAs having a certain or higher degree of homology mean polynucleotides and polynucleotides of the complementary strand thereof having at least 70% degree of homology, preferably at least 90% degree of homology, more preferably at least 95% degree of homology, and most preferably at least 97% degree of homology with the nucleotide sequence of SEQ ID NO.l, SEQ ID NO.2, SEQ ID NO.15, SEQ ID NO.16, SEQ ID NO. 18, or a part thereof or the nucleotide sequence encoding amino acid sequences of SEQ ID NO. 3, SEQ ID NO. 17, or SEQ ID NO.19, or a part thereof.
More specifically, the DNA having the nucleotide sequence which hybridizes with the DNA having a nucleotide sequence of SEQ ID NO.l, SEQ ID NO.2, SEQ ID NO.15, SEQ ID NO.16 or SEQ ID NO. 18 or a part thereof under the stringent condition of 0.2 X SSC containing 0.1% SDS at 50°C or 1 x SSC containing 0.1% SDS at 60°C can be exemplified.
Among the DNA of the present invention, particularly the followings can be prepared by any method known to those skilled in the art such as chem.ical synthesis, genetic engineering technique and mutagenesis:
DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/or substituted in the nucleotide sequence or a part thereof of SEQ ID NO.l or SEQ ID NO,15, and is involved in restoration of the cytoplasmic male sterile individual to fertility;
DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/or substituted in the nucleotide sequence or a part thereof of SEQ ID NO,2, SEQ ID NO. 16, or SEQ ID NO. 18, and is involved in restoration of the cytoplasmic male sterile individual to fertility; and
DNA encoding a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/or substituted in the amino acid seq.nce or a part thereof of SEQ

ID NO.3, SEQ ID NO.17, or SEQ ID NO.19, and is involved in restoration of the cytoplasmic male sterile individual to fertility. For example, by using DNA having a nucleotide sequence or a part thereof of SEQ ID NO.l, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 16, or SEQ ID NO. 18, a mutated gene can be obtained by introducing mutation to these DNA.
As the method for obtaining a mutant gene, known methods such as random mutant, mutant with target, a method using a synthetic gene (Sin Idensi Kougaku Handbook. Zikken Igaku Sppl. , Youdosya. 1996) can be employed.
Specifically, there can be used a method of contacting the DNA having the nucleotide sequence or a part thereof of SEQ ID NO. 1 or 2 with a drug which is a mutagen, a method for irradiating ultraviolet rays to the DNA , genetic engineering technique, and the like. Site-directed mutagenesis method which is one of genetic engineering technique is a useful technique since it can introduce a specific mutation to a specific site, and it can be carried out according to the method described in Molecular Cloning, 2nd edition.
(4) Vector containing DNA of the present invention
DNA of the present invention can be used as a recombinant vector by introducing it in an appropriate vector. The type of the vector may be an expression vector or a non-expression vector and can be selected in accordance with the purpose.
A preferable cloning vector is that capable of autonomous replication in a K12 strain of Escherichia coli, and either a phage vector or plasmid vector can be used. The vector for expression in Escherichia coli may be used as the cloning vector . Specifically, the examples include ZAP Express (Strata Gene, Strategies, 5, 58 (1992),) pBluescrlpt II SK ( + ) (Nucleic Acids Research, 17, 9494 (1989)), Lambda ZAP II (Strata Gene), I gtlO, λgtll (DNA Cloning, A Practical APPRoach, 1, 49 (1985)), λ TriplEx (Clonetec) , λ ExCell (Pharmacia) , pT7T318U (Pharmacia) , pcD2 (Mol. Gen. Biol. , 3, 280 (1983) ) , pMW218 (Wako

Pure Chemicals), pUCllS (Takara) , pEG400 (J. Bac, 172, 2392
(1990)), and pQE-30 (QIAGEN).
The expression vector can be selected in consideration of combination with the host, and preferably, a vector which is capable of autonomous replication in the host cell or integration into a chromosome and contains a promoter in a position which enable transcription of the gene of the present invention, is used.
In the case where a bacteria is used as the host cell, it is preferable that the expression vector for expression of DNA is capable of autonomous replication in the bacterial cell and also that it is a recombinant vector composed of the promoter, a ribosome binding sequence, the above DNA, and a transcription termination sequence. A gene for regulating the promoter may be contained.
As the expression vector for bacteria is exemplified by pBTrP2 , pBTacl, pBTac2 (all commercializedby Boeringer Manheim) , pKK233-2 (Pharmacia),pSE280 (Invitrogen), pGEMEX-1 (Promega), pQE-8 (QIAGEN), pQE-30 (QIAGEN), pKYPlO (Japanese Patent Laid-openPublicationNo.58-110600) , pKYP200 (Agrc.Biol. Chem., 48, 669 (1984) ) , PLSAl (Agrc. Biol .Chem. , 53, 277 (1989) ) , pGELl
(Proc.Natl.Acad.Sci.USA, 82, 4306 (1985)), pBluescrlptll SK+, pBluescriptll SK(-) (Stratagene), pTrS30 (FERMBP-5407), pTrS32(FERMBP-5408),pGEX (Pharmacia),pET-3 (Novagen),pTerm2
(US 4686191, US 4939094, US 5160735) , pSupex, pUBllO, pTP5, pC194, pUC18 (Gene, 33, 103 (1985) ) , pUC19 (Gene, 33, 103 (1985) ) , pSTV28
(Takara), pSTV29 (Takara), pUC118 (Takara), pPAl (Japanese Patent Laid-open Publication No.63-233798) , pEG400
(J.Bacterid. , 172, 2392 (1990)), and pQE-30 (QIAGEN). As the promoter for bacteria is exemplified by promoter derived from Escherichia coli and phage such a.s trp promoter (P trp) , lacpromoter (P lac) , PL promoter, PR promoter and PSEpromoter, as well as SPOlpromoter, SP02promoter, and penPpromoter,
As the expression vector for yeast is exemplified by YEpl3
(ATCC37115) , YEp24 (ATCC37051) , Ycp50 (ATCC37419) , pHS19 and

pHS15 . As the promoter for yeast is exemplif iedby PHOSpromoter, PGKpromoter, GAPpromoter, ADHpromoter, galIpromoter, gallOpromoter, heat shock protein promoter, and also promoters
such as MF a Ipromoter and CUPlpromoter.
As the expression vector for an animal cell is exemplified
by pcDNAI, pcDM8 (commercialized by Funakoshi), pAGE107
(Japanese Patent Laid-open Publication No.3-22979;
Cytotechnology, 3, 133, (1990)), pAS3-3 (Japanese Patent
Laid-open Publication NO.2-227075) , pCDM8 (Nature, 329, 840,
(1987)) , pcDNAI/AmP (Invitrogen) , pREP4 (Invitrogen) , pAGE103
(J. Biochem., 101, 1307 (1987)), andpAGE210. As the promoter
for animal cell is exemplified by the promoter of IE (immediate
early) gene of cytomegarovirus (human CMV) , an early promoter
of SV40, a retrovirus promoter, metallothionein promoter, heat
shock promoter and SRapromoter.
As the expression vector for plant cell is exemplified by pIG121-Hm (Plant Cell Report, 15, 809-814 (1995)), pBI121
(EMBOJ. 6, 3901-3907 (1987)), pLAN411 and pLAN421 (Plant Cell Reports 10 (1991) 286-290) . When a long DNA fragment of lOkb or longer is introduced to a plant, it is desired to use a vector which was improved so as to allow a stable hold and introduction of long strand DNA. For example, pBIBAC2 (Gene 200 (1997) 107-116), PYLTAC7 (PNAS 96 (1999) 6535-6540) and pBIGRZ2
(Bioscience and Industry 55 (1997) 37-39) are exemplified.
The promoter for plant cell is exemplified by cauliflower mosaic virus 35S promoter (Mol. Gen. Genet (1990) 220, 389-392). A detail of transformation of plant will be described later.
(5) Transformant having DNA of the present invention
The transformant having DNA of the present invention can be prepared by introducing the above mentioned recombinant vector (preferably the expression vector) into a host.
Specific examples of the host cell of bacteria include
microorganisms belonging to Escherichia, Corynebacterium,
Brevibacterium, Bacillus, Microbacterium, Serratia,

Pseudomonas, Agrobacterium, Alicyclobacillus, Anabaena, Anacystis, Arthrobacter, Azobacter^ Chromatium, Erwinia, Methylobacterium, Phormidium, Rhodobacter, Rhodopseudomonas^ Rhodospirilium, Scenedesmun, Streptomyces, Synnecoccus and Zymomonas. The method for introducing the recombinant vector to bacterial host is exemplified by a method using a calcium ion and a protoplast method.
Specific examples of a yeast host include Saccharomyces cerevisae, Schizosaccharomyces pombe, Kluyveromyces lactis, Trichosporon pullulans, and Schwanniomyces alluvius.
The method for introducing the recombinant vector into yeast host may be any method for introducing the DNA to the yeast, and examples thereof include electroporation method, spheroplast method, and lithium acetate method.
The host for the animal cell is exemplified by Namalva cell, COSl cell, C0S7 cells, and CHO cell.
As the method for introducing the recombinant vector to the animal cell, any method capable of introducing DNA to animal cell can be used. For example, electroporation method, calcium phosphate method and lipofection method can be used.
Transformant using the plant cell will be described later.
(5) Method for obtaining the protein of the present invention The method for obtaining the protein of the present invention is not particularly limited. On the basis of information obtained by combining the amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17 or SEQ ID NO. 19 disclosed in the present specification or the PPR motif or the mitochondria transit sequence obtained on the basis of information of the amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17 or SEQ ID NO. 19, the protein of the present invention can be isolated, expressed or synthesized by applying the general genetic engineering technique known to those skilled in the art.
For example, the protein of the present invention can be expressed by isolating or synthesizing DNA encoding a protein

of the present invention and introducing it into cell.
The protein of the present invention can be obtained by, for example , culturinga transformant havinga gene of the present invention, producing and accumulating the protein of the present invention in the culture, and collecting the protein from the culture.
The method for culturing a transformant having a gene of the present invention can be carried out according to an ordinary method used for culturing the host.
In the case where the transformant of the present invention is a procaryote such as Escherichia coli or an eucaryote such as yeast, a culture medium for culturing these microorganisms may be either of natural medium or synthetic medium, so long as these culture media contains a carbon source, nitrogen source, inorganic salts which can be used by these microorganisms, and can realizes an efficient culturing of the transformant. Culturing is preferably carried out under an aerobic condition such as a shaking culture or an aerated and agitated submerged
culture, a culture temperature ranges normally from 15 to 40 "C, and culture duration time ranges normally from 16 hours to 7 days. The pH during the culture is kept ranging from 3.0 to 9.0. pH adjustment is carried out by using an inorganic or organic acid, an alkali solution, urea, calcium carbonate, ammonium or the like. Further, if necessary during culturing, an antibiotic such as Ampicillin or tetracycline may be added to the culture medium.
As the culture medium for culturing the transformant obtained by using the animal cell as the host cell, there is used RPM11640 medium which is commonly used (The Journal of the AmericanMedical Association, 199, 519 (1967) , Eagle ' sMEMmedium (Science, 122, 501 (1952) ) , DMEMmedium (Virology, 8, 396 (1959) ) , 199 mediiim (Proceeding of the Society for the Biological Medicine, 73, 1 (1950)) , or the medium prepared by adding bovine fetus serum to any one of these media. Culturing is normally conducted under the condition of pH ranging from 6 to 8, a temperature

ranging from 30 to 40oC, 5% CO2 for 1 to 7 days. Moreover, if necessary during culture, an antibiotic such as kanamycin or Penicillin may de added to the culture medium.
As the culture medium for transformant obtained by using the plant cell as the host cell, there is used any medium such as MS medium, R2P medium and others, which are commonly used in accordance with plant species . Culturing is carried out for
1 to 21 days under the condition of pH 6 to 8 and 15 to 35°C. If necessary during culture, an antibiotic such as kanamycin or hygromycin may be added to the culture medium.
In order to isolate and purify the protein of the present invention which is involved in restoration of cytoplasmic male sterile individual to fertility from a cultured product of the transformant, ordinary isolation and purification methods may be used.
For example, when the protein of the present invention is expressed intracellularly in a dissolving state, after completion of culturing, the cells are collected by centrifugation and suspended in an aqueous buffer solution and then, the cells are broken by using an ultrasonic breaking machine , a French press, Manton Gaulin homogenizer, Dynomill to obtain a cell free extract solution. From a supernatant obtained by centrifugation of the cell free extract solution, a purified sample product can be obtained by using an ordinary protein isolation and purification method, such as solvent extraction method, salting-out method using ammonium sulfate and the like, desalination method, precipitation method using an organic solvent, anion exchange chromatography method using such resin as diethylaminoethyl (DEAE) Sepharose or DIAION HPA-75 (Mitsubishi Chemical Corp), cation exchange chromatography method using S-Sepharose FF (Pharmacia), hydrophobic chromatography method using such resin as butyl Sepharose or phenyl Sepharose, gel filtration method using a molecular sieve, affinity chromatography method, chromatofocusing method, and electrophoretic method such as isoelectric focusing.

independently or in combination.
In the case where the protein is intracellularly expressed with forming an insoluble matter, the protein is collected from a fraction of precipitation which is obtained by collecting, destroyiong and centrifuging cells similarly, by an ordinary method. Then, the insoluble matter of the protein is solubilized by a protein-denaturing agent. A solution of the solubilized protein is diluted or dialyzed by a solution which lacks the protein-denaturing agent or contains the protein-denaturing agent at such a low concentration that the protein denaturation does not occur, so as to construct a normal stereoscopic structure of the protein. Then, a purified sample product can be obtained by the same isolation and purification method as those described above.
In the case where the protein of the present invention or its derivative such as sugar-modified molecule is extracellularly secreted, the protein or derivative such as the sugar chain-added molecule can be collected in the supernatant of the culture. The solubilized fraction is obtained by treating the culture product by techniques such as centrifugation as described above, and the purified sample product can be obtained from the solubilized fraction by using the isolation and purification method as described above.
The protein of the present invention can also be produced by such chemical synthesis method as Fmoc (fluorenyl methyl oxycarbonyl) method or tBoc (t-butyl oxycarbonyl) method. Further, synthesis can be performed by using a peptide synthesizer commercially available from Souwa Boueki (Advanced Chemtech, USA) , Perkin Elmer Japan (Perkin Elmer, USA) , Amerciam Pharmacia Biotech (Amerciam Pharmacia Biotech) , Aroca (Protein Technology Instrument, USA) , Kurabou (Synthecell-Vega, USA) , Japan PerSeptive Ltd. (PerSeptive, USA), and Shimadzu Corporation.
(7) Transformant of the plant having DNA of the present invention

The nucleotide sequence of SEQ ID NO.l and SEQ ID NO. 15 are the nucleotide sequence in a form in which the nucleotide sequence of the original genome of the plant has been extracted. This nucleotide sequence contains a promoter and a terminator necessary for gene expression in an operable form. Concerning the vector to be introduced, cloning of the gene can be performed in an ordinary cloning vector such as cosmid pWE15 (STRATAGANE) in a direct introduction method. In case of using AgroJbacteriun], cloning can be performed in an ordinary plant transformation vector such as pB1121 (Clontech).
The DMA of the nucleotide sequence from which a part of introns have been extracted from this (genomic) sequence, DNA of the nucleotide sequence from which almost all introns have been extracted, DNA of SEQ ID NO. 2 or 238th to 2064th nucleotides thereof, DNAof SEQ IDNO. 16 or 238th to 2064thnucleotides thereof, DNA of SEQ ID NO. 18 or 244th to 2073th nucleotides thereof, or DNA encoding a protein of SEQ ID NO. 3 or a region of 80th to 687th residues thereof, SEQ ID NO. 17 or a region of 80th to 687th residues thereof, or SEQ ID NO. 19 or a region of 82th to 690th residues thereof, may be introduced to the plant cell.
DNA having a sequence from 3754th to 5091th nucleoties of the nucleotide sequence of SEQ ID NO. 1 or DNA having a sequence from 1st to 811th nucleotides of the nucleotide sequence of SEQ ID NO.15 is the promoter having an ability of transcribing an mRNA in an anther, and is preferably used for restoration from male sterility.
In addition, the promoter and terminator regions may be replaced with a promoter and a terminator which work in a known plant cell.
In the case where the above DNA of SEQ ID NO. 2 or 238th to 2064th nucleotides thereof, DNA of SEQ ID NO. 16 or 238th to 2064th nucleotides thereof, DNA of SEQ ID NO. 18 or 244th to 2073th nucleotides thereof, or DNA encoding a protein of SEQ ID NO. 3 or a region of 80th to 687th residues thereof, SEQ ID NO. 17 or a region of 80th to 687th residues thereof, or SEQ ID NO, 19 or

a region of 82th to 690th residues thereof, is introduced into the plant cell, the promoter and the terminator are necessary in addition to this DNA, Commonly used ordinary expression vector is exemplified by pB1121 (Clonetech). In this vector, 35S promoter of cauliflower mosaic virus is used as the promoter, and the terminator of nopaline synthesis enzyme, which is present in Ti plasmid of A, tumefacience, is used as the terminator. As the promoter necessary for expression, not only the above described 35S promoter of cauliflower mosaic virus, but also rbcS promoter widely present in plants may be used. More preferably, a promoter such as TA29 promoter which is expressed in a developing period of pollens, and further preferably authentic promoters located in the upstream of the genes, are used. As the terminator, not only the above described terminator of nopaline synthesis enzyme, but also 35S terminator of cauliflower mosaic virus can be used. More preferably, an authentic terminator located in the downstream of the gene is used.
In the case where the above DNA of SEQ ID NO. 2 or 238th to 2064th nucleotides thereof, DNA of SEQ ID NO. 16 or 238th to 2064th nucleotides thereof, DNA of SEQ ID NO. 18 or 244th to 2073th nucleotides thereof, or DNA encoding a protein of SEQ ID NO. 3 or a region of 80th to 687th residues thereof, SEQ ID NO.17 or a region of 80th to 687th residues thereof, or SEQ ID NO. 19 or a region of 82th to 690th residues thereof is used for the purpose of restoration of cytoplasmic male sterile individual to fertility, a mitochondrial transit sequence is necessary in addition to these sequences.
As the mitochondrial transit sequence, there is used DNA of 1st to 237th nucleotides of SEQ ID NO. 2 or DNA encoding 1st to 79th amino acids sequence of SEQ ID NO. 3; DNA of 1st to 237th nucleotides of SEQ ID NO. 16 or DNA encoding 1st to 79th amino acids sequence of SEQ ID NO. 17; DNA of 1st to 243th nucleotides of SEQ ID NO. 18 or DNA encoding 1st to 81th amino acids sequence of SEQ ID NO.19; or the other known transit sequence mentioned

above.
In the following examples, the present inventors have prepared the vectors for plant transformation in order to introduce the DNA (SEQ ID NO.l) of the Rf gene which contains introns contained in regions from the authentic promoter present in the genome to the terminator, to the plant in an authentic form. After cleavage of the nucleotide sequence of SEQ ID NO.l from the clone composing a part of the contig by a restriction enzyme, the sequence was subcloned into an appropriate cloning vector. Then, the subcloned fragment was introduced into the vector pKM424 and pBIGRZ2 for plant transformation to obtain the vector which can introduce the fragment into the plant. This vector was introduced into Agrobacterium for plant transformation . By infectingAgrobacteriu/nholdingthis vector to the plant, the DNA fragment is integrated into a plant genome.
The plant to which the gene of the present invention can be applied is exemplified by oil crop such as rapeseed, sunflower, soybean and palm, cereals such as rice, maize and wheat, flowering plants such as tobacco and petunia, and various vegetables such as tomato, broccoli, cabbage, Chinese cabbage and carrot.
Among these, Brasslca plants such as rapeseed, cabbage, Chinese cabbage and broccoli, and tomato are preferable. Rapeseed, cabbage, Chinese cabbage andbroccoli are particularly preferable, and rapeseed is most preferable.
In the present specification, the plant source for transformation is exemplified by a seed, a germ, a shoot, a callus , a cultured cell, and a plant body. For example, the germ or a protoplast in case of rapeseed; the seedling, the callus or the cultured cell in case of soybean; the seedling in case of sunflower; the callus or the cultured cell in case of palm; the seedling, the callus, the cultured cell or the protoplast in case of rice; the seedling, the shoot, the callus, the cultured cell or the protoplast in case of maize; the seedling, the callus or the cultured cell in case of wheat; the seedling, the callus, the cultured cell or the protoplast in case of cabbage and

broccoli; the seedling, the callus, the cultured cell or the protoplast in case of carrot. Preferred portions are appropriately selected depending on the subject plant, as those skilled in the art ordinarily perform.
Transformation of plant can be conducted by ordinary ways . For example , there are the method in that the vector is introduced into the plant by infecting a plant cell with Agrobacterium after the vector is once introduced to an Agrojbacteriu/n cell, and the method in that the vector is directly introduced into the cell by using, for example, electroporation method, DEAE dextran method, calcium phosphate method, polyethylene glycol method, and particle gun method.
For example, the preferred method for introducing a gene in the case of rapeseed is exemplified by the method described below.
A hypocotyl of a form of rapeseed aseptically germinated in the MS medium containing a sugar such as sucrose as the carbon source is precultured on the MS medium containing 2,4-dichlorophenoxy acetic acid and sucrose. Agrobacterium grown on YEB medium is collected by centrifugation and is suspended again on the MS medium containing sucrose. The above described hypocotyl of rapeseed is added in this suspension followed by shaking. Then, the hypocotyl taken out is returned to the original preculture medium for co-culture for 3 days followed by transfer to a selection medium containing plant hormones such as Zeatinandbenzylaminopurine, and carbenicillin and kanamycin for selection. A regenerated individual is obtained by culturing the obtained regenerated green buds in a growth culture medium optionally containing a plant hormone such as benzylaminopurine and then in a rooting culture medium optionally containing plant hormones such as naphthalene acetic acid and benzylaminopurine. By crossing this individual with the individual of the cms line, Fi hybrid of which fertility has been restored can be obtained.
The introduction of DNA of the present invention into

the plant can enable restoration of cytoplasmic male sterile individual to fertility.
For the regenerated plant as described above, expression can be confirmed by crossing it with rapeseed of the cms line and examining fertility of offspring thereof . In the case where transformation is conducted using a rapeseed plant having the cms character as a material, pollen fertility can be examined by transferring the transformant (regenerated individual), which has produced a root by the way described above, to soil containing an ordinary fertilizer to flower. This procedure is preferable in view of temporal and operational convenience.
In the above trans formant, in the case where trans formation is conducted as described above using the cell or the tissue, preferably the hypocotyle, a cotyledon, a leaf, a pollen, the cultured cell, the callus, and the protoplast of rapeseed plant which has cms cytoplasm as the cell source, the plant of which pollen fertility has been restored can be obtained by transferring the plant (regenerated individual) which has produced by the above method to soil containing the ordinary fertilizer to flower.
The plant body in which the DNA has been integrated in the nucleus can be obtained by introducing the DNA of the present invention into the cms cell by the gene introducing method as described above using the cms cell, selecting the cell in which the DNA is integrated in the nucleus using a selection marker of tolerance against an antibiotic such as kanamycin or tolerance to herbicide as an index, and then culturing the cell in the growth culture medium or the rooting culture medium as described above . In this plant body, fertility is restored from the male sterile character.
For detecting the gene involved in restoration to fertility, the applicable method is that 15 to 50mer oligonucleotide primer freely designed from the DNA of any of claims 1 to 4 or probe of at least 15 mer consisting of all or a part of the DNA of any of claims 1 to 4 is used, and the quantity of the nucleotide

sequence amplifiedby the primer or the quantity of the nucleotide sequence detected by the probe in an organism sample of interest is confirmed to be 1 gene or more in 1 genome.
Specific technique for confirmation is exemplified by PCR method and Southern hybridization method, and among them, PCR method is preferable. These techniques can be conducted according to the method described in Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY. 1989 (hereafter abbreviated to Molecular Cloning 2nd Ed.)
For confirming that there is 1 gene or more in 1 genome, by applying PCR method, it is necessary that as a simplified technique, a same degree of amplification can be observed by using a same number of copy of the DNA as a template. More accurately, in the same biological sample of a same amount, the quantity of this amplified known gene is compared with the quantity of the nucleotide sequence amplifiedby using the primer by applying quantitative PCR method using an optional primer for amplifying a known gene as an internal standard in which 1 gene presents in 1 genome. In Southern hybridization method, the DNA of the plant of the fertility-restorer line in which 1 gene present in 1 genome is compared with the DNA of the objective plant sample at an equal amount, and then it is tested that the quantities of the DNAs detected are same or larger.
The primer used in PCR method is exemplified by the 15 to 50mer oligonucleotide identical or having complementation to the DNA sequence of SEQ ID NO.l or SEQ ID NO. 2.
The probe used in Southern hybridization method is exemplified by a total region of a double strand DNA identical to the DNA sequence of SEQ ID NO.l or SEQ ID NO. 2, or a part of at least 15mer or more thereof, or the total region of a single strand DNA or a complementary strand thereof,or a part of at least 15mer or more thereof. Moreover, DNA having a certain or higher degree of homology to the nucleotide sequence of the DNA which is used as the probe as mentioned above may be used.

The certain or higher degree of homology used hereby is, for example 70% or higher, preferably 80% or higher, more preferably 90% or higher, further preferably 93% or higher, particularly preferably 95% or higher, and most preferably 97% or higher. The DNA having the certain or higher degree of homology includes both of the polynucleotide having homology described above and the polynucleotide of the complementary strand thereof.
The method for detection of the gene as described above can be applied as means of not only confirmation of integration of the DNA into the transformant, but also confirmation of presence of the Rf gene in the individual to which introduction of the Rf gene is attempted by crossing. By using this method, the presence of the Rf gene can be confirmed before flowering, in the case where the Rf gene is introduced into the cytoplasmic male sterile individual. In the case where the Rf gene is introduced to the plant having an ordinary cytoplasm, fertility of the individual of the next generation obtained by crossing the pollen in a flowering stage with the cytoplasmic male sterile individual should be confirmed, but the presence of the Rf gene can be confirmed before this step by using the present method. Such method of use is generally called use of a marker DNA or marker DNA breeding. The Rf gene may be used as the marker DNA of the Rf gene (rf marker) . The Rf marker is , as described above, important for breeding a commercial plant variety by using a recombinant to which the DNA has been introduced, and a non-recombinant plant to which the Rf gene has been introduced by crossing, as a mother plant.
Whether or not the introduced DNA works as Rf gene can be confirmed by confirming restoration of fertility of the transformant as mentioned above, and also by the method presented below.
As described above, the Rf gene restores fertility of the plant body by reducing an amount of ORF 125 or ORF 138 protein being the cms-associated protein, which is accumulated in the mitochondria. Therefore, by confirming the reduction of the

amount of ORF 125 or ORF 138 protein accumulated in the mitochondria of the transformant, it can be confirmed that the introduced gene is the Rf gene.
The method for confirming the reduction of the amount of ORF 125 or ORF 138 protein accumulated in the mitochondria is, for example, a method of confirming that the hybridizing signal amount of an antibody against the protein derived from a mitochondrial genome used as the internal standard, such as anti F1-F0 ATPase (hereafter abbreviated to ATPA) described in N. Koizuka et al. Theor Appl Genet, 100: 949-955, 2000, is equal between the cytoplasmic male sterile individual and the transformant in which the DNA has been introduced to the fertility-restored plant or the cytoplasmic male sterile individual, when ORF 125 or ORF 138 protein is detected by Western blotting method according to the condition described in the present specification, and that the amount accumulated in the transformant produced by introducing the DNA to the fertility-restored plant or the cytoplasmic male sterile individual has been reduced by more than 50%, preferably 60% or more, more preferably 80% or more as compared with the amount of ORF 125 or ORF 138 protein accumulated in the cytoplasmic male sterile individual.
Practically, in a flower bud of the cytoplasmic male sterile radish plant having ORF 125, when the fertility-restorer gene Rf is introduced, the amount of ORF 125 protein accumulated is reduced markedly resulting in almost no detection. In rapeseed, in a flower bud of the fertility-restored rapeseed plant in which the fertility-restorer gene has been introduced to the cytoplasmic male sterile rapeseed which has the ORF 125 by crossing, it has been observed that the amount of ORF 125 protein accumulated is reduced by 80% or more. In the example, in the flower bud of the transformant rapeseed in which the gene has been introduced to the cytoplasmic male sterile individual, it has been observed that the amount of ORF 125 protein accumulated is reduced by 80% or more.

The antibody against ORF 125 and ORF 138 protein in the method as described above can be obtained by the following common technique. These proteins are immunized to an animal as an antigen to obtain an antiserum, and immunogloburin G antibody can be purified by using protein A-bound affinity column. The antigen to be used can be obtained by purifying the protein from the cytoplasmic male sterile individual which expresses it and the cultured cell by an ordinary method. In addition, the antigen is also obtained by combinging ORF 125 and ORF 138 genes to the expression vector to express it in Escherichia coli and yeast followed by purification in the similar way. Moreover, the peptide obtained by chemically synthesizing a full length or a part of ORF 125 and ORF 138 can be used as the antigen. The antibody against ATPA can also be obtained by the similar technique.
Further, by introducing a part or all of the gene of the present invention to the cell having a cms cytoplasm and/or the DNA of the present invention together with the induction promoter, the expression of cms can be regulated specifically and temporarily, and thus a new hybrid seed production system which need not a male sterility-maintaining line (maintainer) and/or restorer line (Rf line) necessary for hybrid seed production can be produced.
That is, rapeseed of the cms line is normally sterile and thus, propagation and maintenance of the cms line requires the maintainer in which cms and Rf are not involved. Therefore, so far, production of a hybrid seed required plants of 3 lines, namely, the Rf line, the cms line, and the maintainer. However, because Rf gene was isolated and identified by the present invention and hence, applying the method for conducting induction of the promoter by a chemical substance in hybrid production so as to regulate expression of the restorer gene allows construction of the cms line capable of propagation and maintenance even without the maintainer.
Specifically, a full length or a part of the gene of the

present invention is integrated into a vector having the promoter induced from outside, for example, the drug sensitive promoter, in an antisense or a sense direction or is constructed vector to induce gene silencing with the inducible promoter. Then, the cell having the cms cytoplasm and DNA of the present invention or having the cms cytoplasm alone is transformed by using the vector.
The cell having the cms cytoplasm and/or DNA of the present invention may be not only the cell obtained by transforming a cell having the cms cytoplasm with DNA of the present invention by the method as described above, but also the cell obtained by crossing the cms line with the Rf line.
The inducible promoter described above is known, for example, from Japanese Patent Laid-open Publication No. 6-46697 , and the method for preparation of the vector and transformation is exemplified by the techniques similar to those described above.
The promoter is not induced usually in the transformant, which is the cell obtained by the method as described above, has the cms cytoplasm, and has or has not DNA of the present invention, and to which a part or all of DNA of the present invention is integrated together with the induction promoter. Therefore, the plant which carry the vector designed for up-regulation above described gene shows fertility when the induction is applied or the plant which carry the vector designed for down-regulation of the gene shows fertility caused by the inhibition of the endogenous Rf gene expression, and maintenance of the line can be carried out by self pollination. In the production of the hybrid, the chemical substance having an ability of inducing the promoter is acted on the plant which carry a vector can downregulate the endogenous Rf gene and thus, expression of the Rf gene is inhibited. Thus, the plant becomes male sterile and hence, can be used as the cms line in the production of the hybrid seed. Futhermore, when the cms line having both the endogenous Rf gene and the downregulation

construct, Rf line so far required for hybrid seed production is not needed. Therefore, every rapeseed cultivars or lines without Rf gene can be used as pollen donor (father) . Thus in addition to the unnecessary of the maintainer, the Rf line becomes unnecessary and a production cost can be reduced considerably.
Applying these methods allow propagation and maintenance by self pollination even in the cms line. Consequently, though 3 lines are so far required for production of the hybrid seed, it becomes possible that the maintainer becomes unnecessary and a production cost can be reduced considerably.
The contents disclosed in each specification of Japanese Patent Application Nos. 2001-128008, 2001-202082 and 2002-20083 , baaed on which the present application claims priorities, should be understood to be incorporated in the present specification by reference.
Examples of the present invention are given below in detail, but the following examples are in no way intended to limit the scope of the present invention.
Examples
Example 1: Isolation of DNA marker which is linked with the cytoplasmic male fertility restorer gene, and preparation of the genome map
For isolation of the fertility restorer gene (Rf gene), it is first necessary to isolate the DNA marker located around the Rf gene and prepare the genome map showing a relationship between genetic distances of this DNA marker and Rf gene. As the starting point, positional cloning of anRf region was carried out.
As the method for isolating the DNA marker, AFLP was carried out by using AFLP Analysis System I AFLP Starter Kit of GIBCO BRL for AFLP (Amplified fragment length polymorphism) method (Nucleic Acids Research, 1995, Vol. 23, NO.21 4407-4414) . As the material used for measuring the genetic distance from the marker, F2 population of about 2100 individuals which were

obtained by self pollination of eight individuals of radish F1 generation produced by crossing one individual ((KC2/ KA1)-1) of Raphanus sativus cv . Kosena of the cms line with one individual (YuanlO-3) of Raphanus sativus cv. Yuanhong according to the method described in N. Koizuka, et al. , Theor Appl Genet, 100:949-955 2000, was used. As a result, in a form sandwiching the Rf gene, 5 markers linking in the position of the genetic distance of 0 . 2 to 0 . 3 cM from either side of the gene were isolated Fig. 1 shows the genomic map showing the genetic distance of each DNA marker and the Rf gene.
Example 2: Preparing contig and analysis of the Rf gene on the basis on the genomic map
Subsequently to preparation of the genomic map, it is necessary that the genomic DNA corresponding to the position iscloned and the DNA markers sandwiching the Rf gene are linked. Since the DNA markers are distant from the Rf gene and thus, by combining a plurality of clones having the genome DNA fragment, the contig of the Rf_ gene region covering across DNA markers was prepared.
A group of clones having the genome DNA fragment is named a genomic library. We prepared two types of the library. As a DNA donor, the genomic DNA was prepared from Yuanhong radish which is same as the parent of the restorer line used for preparation of the F2 population, by means of CTAB method (Murray, M. G. and Thompson, W. F. (1980) Nucleic Acids Res., 8, 4321) according to an ordinary technique. For the library, a lambda phage library of a 20 kb average length and 1.5 x 10^ population
number was prepared by using I DASHII vector (STRATAGENE) as the lambda vector. As the cosmid vector, the cosmid library of a 40 kb average length and 5.5 x 10^ population number was prepared by using pWEB::TNC vector (EPICENTRE TECHNOLOGIES). In the contig preparation, a lambda clone was first isolated from the lambda phage library prepared in the above using the DNA marker located in both sides of the Rf gene as

an index by plaque hybridization technique. A cosmid clone was isolated from the cosmid library by using colony hybridization technique to complete the contig covering across the DNA markers of both sides as shown in Fig. 1. For the cosmid clones, NIT7/2 and T03-2, which compose a part of the contig, the nucleotide sequence was determined by an ordinary method.
Subsequently, the nucleotide sequence of the cosmid clones NIT7/2 and T03-2 which compose a part of the contig above was analyzed by using 'Genscan" (Mitsubishi Space Software) in consideration of a parameter for Arabidopsis thaliana, of which the genomic DNA sequence is similar to that of radish and the total genome sequence was determined recently. As the result, the promoter region which is seemed to express the Rf gene, the structural gene region containing the intron, and the terminator region were discovered. In addition, the gene having a form to be translated to the protein which introns have been removed from and the amino acid sequence thereof were obtained.
Example 3: Subcloning of the genomic DNA region
Hpal-Swal fragment (8546 bp) of the DNA of the nucleotide sequence from 1st to 8553th of SEQ ID NO. 1, which contains enough regions from the promoter to the terminator which were presumed by 'Genscan", was separated from the vector by gel electrophoresis using agarose (FMC) for fragment collection. A gel containing the DNA fragment was digested by a GELase(Epicentre Technologies) to collect the DNA. Then, cloned fragments were obtained by cleavage of the obtained fragment using a restriction enzyme , BamRl. These DNA fragments were subcloned to pGEM-T easy vector (Promega) to obtain cds6BT/pGEM-T easy. Details will be described below.
1 μg of NIT7/2 cosmid DNA and 10 unit of restriction enzyme Hpal (Takara) were added to 100 μl of IXK restriction enzyme buffer solution (20mM Tris-HCl (pH8.5), 10mM MgCl2, ImM
Dithiothreitol, lOOmM KCl) , and incubated at 37oc for 1 hour. After incubation, 10 μ1 of 3M sodium acetate (pH5.6) and

250μI of ethanol were added and stirred, followed by cooling at -80 °C for 5 minutes, and then the mixture was centrifuged at 15000 rpm and 4 °C for 15 minutes. Supernatant was removed and 1ml of 70% ethanol was gently added thereto, and the mixture
was centrifuged at 15000 rpm and 4 °C for 5 minutes . Supernatant was removed and precipitant was dried using a centrifugal vacuum
dryer for 5 minutes. 89μl of sterilized water was added to the collected DNA precipitant to dissolve DNA.
To the dissolved DNA solution were added 10μI of 10 X H restriction enzyme buffer solution (500mM Tris-HCl(pH7.5) ,
100mM MgCl2, lOmM Dithiothreitol, lOOOmM NaCl) , l^lof lOunit/ 11 1 restriction enzyme SwaI (Takara) , and the mixture was incubated at 25 X^ for 1 hour. llμl of 10X loading buffer solution (1% SDS, 50% Glycetrol, 0.05% Bromophenol Blue) were added.
1. 2g of low melting point agarose, SeaPlaque GTG agarose(FMC) and 150ml of IXTAE (40mM Tris-acetate, ImM EDTA) buffer solution were mixed, and the mixture was heated at 100oC to melt agarose,and cooled down to 45oC while stirring. A comb of 30mm width X 1mm thickness was set on a 14Xi5cm gel tray, and the cooled gel was poured for coagulation. The DNA to which a loading Dye had been added was poured into the gel comb and
subjected to electrophoresis in IXTAE at 30V/ 30cm voltage for 18 hours.
The gel electrophoresed gel was transferred to 0.5Mg/ml of ethidiumbromide/1 X TAE solution for staining for 30minutes . The gel was put on a transilluminator on which 365nm long wave ultraviolet rays were irradiated, and a fragment of interest of 8546 bp was cut out using a sterilized knife. Subsequently, the gel was chopped to make about 1mm square fragment and transferred to 2 ml microtube previously weighed, and the weight of the gel was measured.
lμl of 50XGELase Buffer (2M Bis-Tris (pH6.0), 2M NaCl) per 50mg weight of the gel, was added. The tube containing the
gel was put in a dry heat block incubated at 68 oC, the solution

was stirred sometimes turning over and incubated for 10 minutes to melt the gel completely. This tube was transferred to the
dry heat block incubated to 45 oC and the solution was stirred sometimes turning over and incubated for 5 minutes. 1 unit of GELase (Epicentre Technologies) per 200 mg weight of the gel was added to this tube, and the solution was stirred sometimes turning over and incubated for 30 minutes in the dry heat block
incubated to 45°C.
1/3 volume of 10 M ammonium acetate (pH 7.0) per 1 volume of the gel was added, and the solution was stirred and centrif uged at 15000 rpm for 5 minutes. The supernatant was transferred to a fresh 2 ml microtube, and 2 volumes of ethanol were added thereto. The tube was stirred and centrifuged at 15000 rpm and
4 °C for 20 minutes. The supernatant was removed and 1 ml of 70% ethanol was gently added, and the solution was centrifuged
at 15000 rpm and 4 X^ for 5 minutes . The supernatant was removed and the precipitation was dried by the centrifugal vacuum dryer
for 5 minutes. 20 /i 1 of TE buffer (lOmM Tris-HCl (pH8 . 0) , ImM EDTA) was added to the precipitation and the solution was completely dissolved to collect DNA.
To 20 μ1 of the collected DNA solution were added 10 μ1 of 10 XK restriction enzyme buffer solution (200mM Tris-HCl (pH8.5), 100mM MgClz, 10mM Dithiothreitol, 1000mM KCl),68μl of dHaO, 2μ1 of 10 unit/ M 1 of restriction enzyme BamHI (Takara) , and the mixture was incubated at 30 "C for 1 hour. After incubation, 10μ1 of 3M sodium acetate (pH5.6) and 250μ1 of ethanol were added, and the mixture was stirred and cooled at
-80 °C for 5 minutes, and centrifuged at 15000rpm and 4oC for 15 minutes. The supernatant was removed and 1ml of 70% ethanol was gently added again, and the mixture was centrifuged at
15000rpm at 4 X3 for 5 minutes. The supernatant was removed and the precipitation was dried for 5 minutes using the centrifugal
vacuum dryer. 20 μ1 of sterilized water was added to the collected DNA precipitation to dissolve it. 55μl of sterilized water, 10μ 1 of 10x PCRbuffer solution (lOOmM Tris-HCl (pH8 .3) ,

500mM KCl) , 6μ1 of 25mM MgCl2, 8μ 1 of 2 . 5mM dNTP mix, 1μ 1 of 5 unit/ μl rTaq DNA polymerase (Takara) were added and mixred, and then the mixture was incubated at 72oC for 30 minutes to add dATP to 3' terminal.
The above reaction solution was transferred to an ultrafiltration filter unit, Microcon-50 (Millipore), and centrifuged at 5000 rpm and 4 °C for 20 minutes. Water on a trap was discarded, 100 μl of sterilized water was again added, and the mixture was centrifuged at 5000 rpm and 4 t for 20 minutes. 20M 1 of the TE buffer solution (10mM Tris-HCl (pH8.0), ImM EDTA) was added, the filter unit was removed, and the direction was reversed to attach to the new microtube. The solution was
centrifuged at 3000 rpm and 4°C for 5 minutes to collect the DNA on the filter unit.
lμl of 50ngμl pGEM-T easy vector (Promega) and 6μl of Solution I of DNA Ligation Kit Ver.2 (Takara) were mixed to 5
μ1 of the purified DNA obtained by the above method, and then the mixture was incubated at 16°C for 30 minutes.
The above reaction solution was transferred to the ultrafiltration filter unit, Microcon-50 (Millipore) together with 100 11 1 of sterilized water, and then the solution was centrifuged at 5000rpm and 4 'C for 20 minutes. Water on the trap was discarded, 100// 1 of sterilized water was again added, and the mixture was centrifuged at SOOOrpmand 4oC for 20 minutes . The filter unit was removed and the direction was reversed to attach to the new microtube.
DNA on the filter unit was collected by centrifugation
at 3000rpm and 4 °C for 5 minutes.
DNA collected in the tube was cooled by standing on ice.
30 111 of Escherichia coli DHIOB (Gibco BRL) for electroporation was put in the tube and mixed gently. Escherichia coli cells mixed with DNA were transferred to a cuvette (USA Scientific Plastics) previously cooled on ice for electroporation (distance between electrodes was 1mm) . Using Electro Cell Manipulator 600 (BTX), electroporation was conducted under conditions of

1.25kv, 129 Q , and 50μ F, and then 500μl of SOC culture medium (Gibco BRL) warmed at 37oC was added to the cuvette immediately. The Escherichia coli was transferred to a 10 ml culture tube
and subjected to shake culturingat 37oC for 1 hour. The cultured Escherichia coli was spread on LB agar medium (1% Bacto-Tryptone , 0.5% Bacto-Yeast Extract, 1% NaCl, 1.5% Bacto-Agar) to which
100μg/ml of Ampiciline (Wako Pure Chemicals Ltd.), 20μg/ml of X-Gal (Takara) and ImMof IPTG (Takara) wereadded, and cultured
for 18 hours or longer at 37oC.
A white colony appeared on an agar culture medium was
cultured at 37°C for 18 h or longer on 2ml of LB medium to which 100 μg/ml of Ample ill in was added. The plasmid DNA was extracted from cultured Escherichia coli cells by the ordinary method. It was confirmed that a fragment of interest was cloned in the plasmid DNA by cleavage with restriction enzyme EcoRI (Takara) , and thus cds6BT/pGEM-T easy was obtained.
Individual Escherichia coli DHIOB carrying cds6BT/pGEM-T easy which was obtained by the above method, was cultured at 37 oC for 18 hours on 100ml of LB culture medium to which 100 μg/ml of Ampicillin was added. Purification was carried out by alkali SDS method using Qiagen Midi Kit (QIAGEN).
Example 4-1: Preparation of the vector for plant transformation
(1)
cds6BT/pGEM-Teasy was cleaved with restriction enzyme
EcoRI and then separated from the vector by gel electrophoresis
using agarose for fragment collection. The collected DNA
fragment was cloned in EcoRI site of the vector for plant
transformation pKM424 (a vector in which a fragment of CaMV35S
promoter : GUS gene: NOS terminator were added to pKM424, is pLAN421 (Plant Cell Reports 10 (1991) 286-290) vector) to prepare the vector for plant transformation cds6BT/pKM424. A detail will be presented below.
To 100 M 1 of IXH restriction enzyme buffer solution (50 mM Tris-HCl (pH 7.5) , 10 mM MgCl2, 1 mM Dithiothreitol, 100 mM

NaCl) were added μg of cds6BT/pGEM-T easy DNA and 10 units of restriction enzyme EcoRI(Takara) , and the mixture was
incubated at 37°C for 1 hour.
Subsequently, EcoRI fragment containing cds6BT was separated and collected from cds6BT/pGEM-T easy by the same method as that for collecting the above Hpal-Swal fragment.
To 100 μ1 of IXH restriction enzyme buffer solution (50 mM Tris-HCl (pH 7.5) , 10 mM MgCl2, 1 mM Dithiothreitol, 100 mM
NaCl) were added lμg of the vector for plant transformation pKM424 and 10 units of restriction enzyme EcoRI (Takara), and
the mixture was incubated at 37 °C for 1 hour . After incubation, 100μl of IM Tris-HCl (pH8.0) and 1 unit of Bacterial Alkaline Phosphatase(Takara) were added and mixed. Then,
dephosphorylation was carried out by incubating at 50°C for
1 hour.
200 μ1 of phenol-chloroform saturated by TE buffer solution (10mM Tris-HCl (pH8.0) and ImM EDTA) was added and the mixture was vigorously stirred. Centrifugation was performed at 15000rpm for 5 minutes and then, the supernatant was transferred to a fresh tube. The same operation was repeated again to remove the protein . 20 μl of 3M sodium acetate (pH5 . 6) and 500uI of ethanol were added, and the mixture was stirred and cooled at -80°C for 5 minutes, followed by centrifugation at 15000rpm and 4°C for 15 minutes . The supernatant was removed and 1ml of 70% ethanol was gently added and centrifuged at ISOOOrpm
and 4T^ for 5 minutes. The supernatant was removed and the precipitation was dried for 5 minutes using the centrifugal
vacuum dryer. 100 M 1 of TE buffer solution (lOmM Tris-HCl(pH8.0) , ImM EDTA) was added to the precipitation to
dissolve it completely to make a 10ngμl concentration.
10μl of purified EcoRI fragment, 1μ1 of dephosphorylated pKM424vector, and 11μl of Solution I of DNA Ligation Kit Ver.
2 (Takara) were mixed, and then the mixture was incubated at
16 °C for 30 minutes.
The above reaction solution was transferred to the

ultrafiltration filter unit:Microcon-50 (Millipore) together with 100μl of sterilized water and centrifuged at SOOOrpm and
4 °C for 20 minutes. Water on the trap was discarded, 100μl
of sterilized water was again added, and the solution was
centrifuged at SOOOrpm and 4 °C for 20 minutes. The filter unit was removed and attached to a fresh microtube in a reverse direction.
Centrifugation was carried out at SOOOrpm and 4 oC for
5 minutes to collect the DNA on the filter unit.
The collected DNA contained in the tube was stood on ice
to be cooled. 30μl of Escherichia coli DH10B(Gibco BRL) for electroporation was put in the tube and mixed gently. The Escherichia coli mixed with DNA was transferred to a cuvette for electroporation (USA Scientific Plastics) previously cooled on ice (distance between electrodes was 1mm) . By using Electro Cell Manipulator 600 (BTX) , electroporation was conducted under conditions of 1.2Skv, 129Q and 50μF, and then 500μl of SOC culture medium (GibcoBRL) warmed at 37 μ was added to the cuvette immediately. The Escherichia coli was transferred to a 10 ml
culture tube and subjected to shake culturing at 37μ for 1 hour. The cultured Escherichia coli was spread on LB agar medium (1% Bacto-Tryptone, 0.S% Bacto-Yeast Extract, 1% NaCl, 1.5% Bacto-Agar) to which 50μg/ml of Spectinomycin (Sigma) was added, and cultured for 18 hours or longer at 37oC.
The colony appeared on the agar medium was cultured in
2ml of LB medium to which SO/ig/ml of Spectinomycin was added, at 37 °C for 18 hours or longer. The plasmid DNA was extracted from the cultured Escherichia coli by an ordinary method. It was confirmed that the region from BamEl site to Hpal site was cloned in the plasmid DNA by cleavage with restriction enzyme Hindlll (Takara). The plasmid was named cds6BT/pKM424.
Escherichia coli DHlOB carrying cds6BT/pKM42 4 was cultured in 2S0ml of LB medium to which SO /i g/ml of Spectinomycin was added, at 37°C for 18 hours. Purification was conducted by alkali SDS method using Qiagen Midi Kit (Qiagen Corp).

Example 4-2 : Preparation of the vector for plant transformation (2)
Lambda clone CHI(see Fig. 2, Cloned fragment of length of about 17 kb) carrying enough the nucleotide sequence of SEQ ID NO. 1 was cleaved with a restriction enzyme NotI (Takara) which is located in the multiple cloning site, and then separated from the vector by gel electrophoresis using agarose for collecting the fragment, and the collected fragment was cloned in the NotI site of the vector pBIGRZ2(Bioscience and Industry 55 (1997) 37-39) forplant transformation to prepare the vector CHI/pBIGRZ2 for plant transformation. The detail will be presented below.
To 100μ1 of 1 XH restriction enzyme buffer solution (50mM Tris-HCl (pH7.5), 10mMMgCl2, ImM Dithiothreitol, 100mMNaCl,
0 . 01% BSA, and 0 .01% TritonX-100) were added 1 M g of lambda clone CHI DNA and 10 units of restriction enzyme NotI (Takara) , and
the mixture was incubated at 37°C for 1 hour . The Notl fragment of the lambda clone CHI was separated and collected by the same method as that applied for collecting Hpal-Swal fragment as described above.
To 100μ1 of 1 XH restriction enzyme buffer solution (50mM Tris-HCl {pH7.5), 10mMMgCl2, ImM Dithiothreitol, lOOmMNaCl,
0.01% BSA, and 0.01% TritonX-100) were added lμg of the vector pBIGRZ2 for plant transformation and 10 units of restriction
enzyme Notl (Takara), and the mixture was incubated at 37 t for 1 hour. After incubation, 100μl of IM Tris-HCl (pH8.0) and 1 unit of Bacterial Alkaline Phosphatase (Takara) were added
and mixed, and then the mixture was incubated at 50oC for 1 hour for dephosphorylation.
200 μ1 of phenol/chloroform saturated with TE buffer solution (10mM Tris-HCl (pH8.0) , ImM EDTA) was added, and then the mixture was stirred vigorously. After centrifugation at 15000rpm for 5 minutes, the supernatant was transferred to a fresh tube. The same operation was repeated again to remove the protein. 20μl of 3M sodium acetate (pH5.6) and 500μl of

ethanol was added and stirred, and then cooled at -80oC for 5 minutes, followed by centrifugation at 15000 rpm at 4oC for 15 minutes. The supernatant was removed and 1ml of 70% ethanol was gently added, and the solution was centrifuged at 15000 rpm
and 4oCfor 5 minutes. The supernatant was removed and the precipitation was dried for 5 minutes by using the centrifugal
vacuum dryer. 100μ1 of TE buffer solution (lOmM Tris-HCl (pH8.0), ImM EDTA) was added to the precipitation to dissolve
it completely to make 10ng/μl concentration.
10μ1 of purified NotI fragment, 1 M 1 of dephosphorylated pBIGRZ2 vector, and 11 M 1 of solution I of DNA Ligation Kit Ver.2 (Takara) was mixed, and the mixture was incubated at 16°C for 30 minutes.
The above reaction solution was transferred to the ultrafiltration filter unit Microcon-50 (Millipore) together with 100 Ml of sterilized water, and centrifuged at 5000 rpm and 4 C for 20 minutes. Water on the trap was discarded, 100 M 1 of sterilized water was again added, and the mixture was centrifuged at 5000 rpm and 4°C for 20 minutes . The filter unit was removed, and direction was reversed to attach to a fresh
microtube. The solution was centrifuged at 3000 rpm at 4oC for 5 minutes to collect the DNA on the filter unit.
The collected DNA contained in the tube was stood was on
ice to be cooled. 30μ1 of Escherichia coli DH10B(Gibco BRL) for electroporation was put in the tube and mixed gently. The Escherichia coli mixed with the DNA was transferred to the cuvette (USA Scientific Plastics) for electroporation which was previously cooled on ice (distance between electrodes was 1mm) . By using Electro Cell Manipulator 600 (BTX), electroporation was conducted under conditions of 1.25kv, 129 Q and 50 μF, and
then 500^1 of SOC culture medium (Gibco BRL) warmed at 37 "^C was added to the cuvette immediately. The Escherichia coli was transferred to 10 ml culture tube and subjected to shake culturing
at 37 .°C for 1 hour. The cultured Escherichia coli was spread on LB agar medium (1% Bacto-Tryptone, 0 . 5% Bacto-Yeast Extract,

\ r
1% NaCl, 1.5% Bacto-Agar) to which 25 μ g/ ml of kanamycin (Wako Pure Chemicals) was added, and cultured at 37 oC for 18 hours or longer.
The colony appeared on the agar medium was cultured in 2ml of LB medium to which 25μg/ml of Kanamycin was added, at 37°C for 18 hours or longer. The plasmid DNA was extracted from the cultured Escherichia coli by an ordinary technique. It was confirmed by cleavage with restriction enzyme Hindlll (Takara) that a fragment of interest was cloned in the plasmid DNA. The plasmid was named CHI/pBIGRZ2.
Escherichia coli DH108 earring CHI/pBIGRZ2 was cultured in 250ml of LB medium to which 25μg/ml of Kanamycin was added, at 37 °C for 18 hours. Purification was carried out by alkali SDS method using Qiagen Midi Kit(Qiagen).
Example 5: Transfer of the vector for plant transformation to Agrobacterium
A competent cell of Agrobacterium was prepared, and each of cds6BT/pKM424 vector and CHI/pBIGRZ2 vector obtained in Examples 4-1 and 4-2 was transferred to the prepared Agrobacterium EHAlOl for plant transformation. Details will be given below.
The competent cell for electroporation of Agrobacterium EHA101 was prepared by the following method. The Agrobacterium EHA101 was streaked on LB agar medium to which 50μg/ ml of Kanamycin (Wako Pure Chemicals) and 25μg/ ml of Chloramphenicol(Wako Pure Chemicals) were added, and cultured
at 28oC for 24 hours or longer to obtain a single colony. 20ml of the LB medium to which 50 μg/ml Kanamycin and 25μg/ ml Chloramphenicol were added, was put into a 50ml centrifugal tube, the colony of about 1mm diameter was inoculated and subjected
to shake culturing at 28°C for 40 hours. After 40 hours, a lid of the centrifugal tube was once opened followed by closing, and further culturing was conducted for 4 hours in the same way. The culture solutionwas centrifugedat 1500 Xg and 4oC to collect

the cells . In the tube from which the supernatant was discarded was added 40ml of ice-cooled and sterilized 10% glycerol, followed by resuspension of the cells and centrifugation at 1500 Xg at 4°C for collection of the cells. This operation was repeated twice. 500M 1 of 10% sterilized ice-cooled glycerol was added to the obtained cells for resuspension. 100 M 1 of the cells were dispensed to each of sterilized microtubes and frozen
with liquid nitrogen, and then stored at -80°C in a freezer. Competent cells of Agrobacterium EHAlOl for
electroporation were dissolved on ice. 40μ1 of electrocompetent cells was put in previously cooled 1. 5 ml tubes , and 100 ng of the plasmid DNA of either cds6BT/pKM42 4 or CHI/pBIGRZ2 was added and gently mixed.
Agrobacterium mixed with the DNA was transferred to the cuvette for electroporation (USA Scientific Plastics) which was precooled on ice (distance between electrodes was 1mm) . Byusing Electro Cell Manipulator 600 (BTX), electroporation was conducted under conditions of 1.44 kv, 129 Q and 50μF, and then 500μl of SOC culture medium (Gibco BRL) warmed at 30 oC was added to the cuvette immediately. The Agrobacterium was transferred to 10 ml culture tube and subjected to shake culturing
at 30oC for 1 hour.
As to Agrobacterium to which cds6BT/pKM424 vector was transferred, the cultured Agrobacterium was spread on the LB agar medium (1% Bacto-Tryptone, 0,5% Bacto-Yeast Extract, 1% NaCl, 1.5% Bacto-Agar) to which 50μg/ml Kanamycin (Wako Pure Chemicals), 25 μg/ml Chloramphenicol (Wako Pure Chemicals), 50 μg/ml of Spectinomycin (Sigma) and 2 . 5 μ g/ml of Tetracycline (Sigma) were added, and was cultured at 28oc for 24 hours or longer.
As to Agrobacterium to which CHI/pBIGRZ2 vector was transferred, the cultured Agrobacterium was spread on the LB agar medium to which 50μg/ml Kanamycin (Wako Pure Chemicals) , 25 μg/ml Chloramphenicol (Wako Pure Chemicals) and 30μg/ml of Hygromycin (Sigma) were added, and was cultured at 28 oC for

24 hours or longer.
The colony appeared on agar medium was cultured in 2ml of LB medium to which the above antibiotics corresponding to
eachvector was added, at 30oC for 24 hours or longer . Theplasmid DNA was extracted from the cultured Agrobacterium by an ordinary method. It was confirmed by cleavage with restriction enzyme Hindlll (Takara) that cds6BT/pKM424 vector or CHI/pBIGRZ2 vector was transferred to the Agro bacterium. The culture solution of 24 hour culturing which contains the confirmed clone was mixed with an equal amount of sterilized 80% glycerol, and was stored
at -80°C. This clone was used for transformation of rapeseed plant.
Example 6: Preparation of rapeseed transformant
Transformation of rapeseed was conducted as follows. Seeds of CMS rapeseed (SW18) having the cms associated gene or f125 derived from radish was subjected to sterilizing treatment with a 10% hypochloride solution to be germinated on MS medium (T. Murashige and F. Skoog, Physiol. Plant. 15: 485, 1962) containing no hormone . Only a hypocotyl was dissected from a seedling plant 7 to 14 days after germination, cut and divided into a 3 to 5 mm length, and precultured on the MS medium (Sigma; M5519) containing sucrose (3%)and 2, 4-D (1 mg/L) and agarose
(0. 4%) (Sigma; Type I) at 23oC for 12 to 16 hours. In this time, co-culturing was carried out together with a cell line BY-2 derived from tobacco for nurse culture.
The Agrobacteriu/n containing CHI/pBIGRZ2 was cultured at
28°C for 8 to 48 hours to be grown to about OD600 = 1-0. The cells of the Agrobacterium were suspended in a liquid MS hormone-free medium. The cut hypocotyl was mixed with this Agrobacterium solution, and subj ected to co-culturing for about 20 minutes. After co-culturing, the hypocotyl from which Agrobacterium was removed by a filter paper, was cultured on, for example, the MS basic medium containing vitamin B5 (Sigma; M0404) , sucrose (3%) and 2 , 4-D (1 mg/L) , for 2 days for infection.

After infection, the cotyledon was transferred to the bacteria removed medium obtained by adding an antibiotic Carbenicillin (Pfeizer: zeopen or GIBCO-BRL: Carbenicillin disodium salts) at a concentration of 500 mg/ L to the MS basic medium containing vitamin B5, sucrose{3%) and 2, 4-D (1 mg/L) , so as to remove Agrobacterium,
After passed through 5 days to 1 week on the bacteria removed medium, the hypocotyl was cultured on the MS basic medium containing vitamin B5 , sucrose (1%) , benzylaminopurine (3 mg/L) , Carbenicillin (500 mg/L) as well as silver nitrate (5 mg/L) and Kanamycin for selection (5 to 30 mg/L)(Nakalai Tesque; sulfate of Kanamycin) for 14 days to 21 days. In this time, there may appear a green callus, which should be immediately transferred by inoculating to the medium of the next step.
The medium of the next step is exemplified by the selection medium of, for example, the MS basic medium (Sigma; M5519), sucrose (1%) , benzylaminopurine (3 mg/L) , zeatin(l mg/L) , Carbenicillin (500 mg/L) and Kanamycin(5 to 30 mg/L). The hypocotyl forming the callus from a cut point was transferred
to this culture medium, and was cultured at 23°C for 3 weeks. Then, such transfer was repeated 3 to 5 times for every 3 weeks up to occurrence of the green callus.
The green callus was, at any time when it found, cut from the hypocotyl, and was transferred to the medium having the same composition. Thereafter, when only the green portion was cut and subcultured, an adventitious bud was formed with a probability of 1 to 30%. Subsequently, the adventitious bud was transferred to the B5 basic medium (Sigma; G5893) to which sucrose (3%) andbenzylaminopurine (Img/L) were added, and grown followed by rooting on the MS medium (Sigma; M5519) containing sucrose (3%) , naphthalene acid (0.1 mg/L) and benzylaminopurine (0.01 mg/L).
Example 7: Analysis of the transformant (detection of the DNA transferred)

A leaf was taken from one individual of the transformant, which was obtained in the Example 6 and formed a bud, and the DNA was isolated using DNA isolation kit of Qiagen (DNAeasy Plant Mini).
For 3 sites (sites a, bandc) of the DNA fragment transferred was detected by PCR method (the result is shown in Fig. 3) . The site a is 568 bp from 3186bp to 3753bp nucleotide sequence of SEQ ID NO.l, and as a forward primer "5'-GAAGCAAAAAAGAAAACGAGCAGAG-3'" (SEQ ID NO. 4) and as a reverse primer "5'-CCAAAAATCCGAAATCCGAATAGAC-3'" (SEQ ID NO.5) were used. The site b is 244 bp from 4869bp to 5112bp nucleotide sequence of SEQ ID NO.l, and as a forward primer "5'-CTCGGCTCTGGGTTTAGTGA-3'" (SEQ ID NO.6) and as a reverse primer "5'-TCCACAAACCCTAGCCAACA-3'" (SEQ ID NO.7) were used. The site c is 485 bp from 7766bp to 8250bp nucleotide sequence of SEQ ID NO. 1, and as a forward primer 5'-GCTTATGCTTCTCTGGTTCGCCTC-3'" (SEQ ID NO.8) and as a reverse primer "5'-CTCAGTTTTCGTCACCTTACACAATGC-3'" (SEQ ID NO.9) were used.
To 1 μ 1 of the transformant DNA solution (50 ng/μ 1) were added 12 .1 μl of sterili zed water, 2 // lof 10 xPCRbuffer solution (100mM Tris-HCl (pH8.3), 500mM KCl) , 1.2 μ 1 of 25 mM MgCl2, 1.6 μl of 2.5mM dNTP mix, 1 μ 1 of 10 MM forward primer solution for each site, 1 μl of 10 μM reverse primer solution for each site, 0.1 μl of 5 unit/μl of rTaq DNA polymerase (Takara) , followed by mixing. Then, the DNA was amplified by repeating
35 times a cycle of 94 °C for 40 seconds, 55 "C for 30 seconds and 72 "C for 1 minute. UNOII (Biometra) was used as a thermal cycler. After completion of the reaction, the amplified product was detected by gel electrophoresis under the condition of 4%
Nusive3:l Agarose (FMC)/I X TBE (89 mM Tris-borate, 89 mM boric acid, 2 mM EDTA) buffer solution (see Fig. 3)
As the result, it was found that the site a was not transferred to this transformed rapeseed. It was found that in the remaining two sites (sites b and c) , the amplification

product having the same size to that of a positive control was obyielded and therefore, the DNA was integrated into the transformed rapeseed.
Example 8: Analysis of the transformant (detection of reduced accumulation of the cms associated protein ORF125)
A flower bud of the same plant as that of the Example 7 was taken, and the reduced accumulation of the cms associated protein ORF 125 was analyzed by Western blotting. The result is shown in Fig. 4.
(1) Extraction of the protein from the transformed plant
Protein extraction and Western blotting were carried out according to the method of N. Koizuka et al (Theor Appl Genet (2000) 100: 949-955).
Specifically, 1 flower bud (1mm in length) of the obtained
transformed rapeseed and 100 μ 1 of the ice-coo led buffer solution (50mM Tris-HCl (pH7.5), 2% (W/V) SDS) for protein extraction were put in an ice-cooled mortar and were ground with a pestle. This solution was transferred to a centrifugal microtube and
centrifuged at 15000 rpm for 15 minutes at 4 t . After centrifugation, the supernatant was transferred to a fresh
centrifugal microtube and heated at 100 °C for 5 minutes, Centrifugation was carried out again at 15000rpm and 4oC for 15 minutes, and the supernatant was transferred to a fresh centrifugal microtube to prepare SDS-solubilized protein solution. The concentration of the SDS-solubilized protein solution was measured by Bradford method using a protein quantification kit (Bio-rad). Simultaneously with this operation, the SDS-solubilized protein solution was similarly extracted from flower buds of rapeseed of the cytoplasmic male sterile line and rapeseed of the sterility restorer line, and the concentrations were measured.
(2) Separation of the protein by SDS-PAGE and transfer to a PVDF
membrane: Western blotting

Using 10 % SDS polyacrylamide gel of 7 x 10 cm square,
15 μg of the SDS-solubilized protein was put on 1 lane for separation by electrophoresis. In addition, for comparison of accumulations of ORF125 protein, diluted series of rapeseed of the cytoplasmic male sterile line were put on thegel and separated Electrophoresis was conducted under the condition of 10 mA for 1 hour and 15 mA for 1 hour. After electrophoresis, the protein contained in the polyacrylamide gel was transferred to the PVDF membrane (Millipore) using semi-dry blotting apparatus (Nipppon Electrophoresis) under the condition of 100 mA for an hour.
(3) Detection of the protein using an antibody: Western blotting
The PVDF membranes to which the protein was transferred
were cut into halves and transferred to 10 ml of a blocking solution
(20mM Tris-HCl (pH 7.5), 500 mM NaCl, 0.05% Tween20, 5% skim milk) , and were blocked by shaking for an hour. ATPA was detected on the top PVDFmembrane as the control of amitochondrial protein , and ORF125 which is the protein involved in the cytoplasmic male sterility was detected on the bottom PVDF membrane. The PVDF membrane was transferred to 10 ml of a primary antibody reaction solution (100μl of an ATPA monoclonal antibody for detection of ATPA was added to 10ml of the blocking solution, and 2μ1 of rabbit antiserum against ORF125 for detection of ORF125 was added (M. Iwabuchi et al. , Plant Molecular Biology (1999) 39: 183-188)), and shaken for 18 hours. The PVDF membrane was transferred to 100 ml of TTBS (20 mM Tris-HCl (pH7.5) , 500 mM NaCl, 0.05% Tween20) and shaken for 10 minutes. This operation was repeated 3 times to wash out an excessive primary antibody solution. The PVDF membrane was transferred to 10 ml of a secondary antibody reaction solution (to 10ml of the blocking solution were added 10μ 1 of peroxidase labeled goat anti-mouse IgG (Amersham) for detection of ATPA and 10μ1 of alkali phosphatase labeled goat anti-rabbit IgG (Bio-rad) for detection of ORF125 respctively (M. Iwabuchiet al. Plant Molecular Biology
(1999) 39 : 183-188) ) , andboth solutions were shaken for an hour.

The PVDF membrane was transferred to 100ml of TTBS (20 mM Tris-HCl (pH7 . 5) , 500mMNaCl, 0 , 0 5%Tween2 0) , and was shaken for 10 minutes This operation was repeated three times to wash out an excessive secondary antibody solution. Achemiluminescence system "ECL+" (Amersham) for peroxidase was used for detection of ATPA and exposure was carried out for 5 seconds for detection. For detection of ORF125, BCIP/NBT (MOSS Inc.) which is a coloring substrate for alkali phosphatase was used, and coloration and detection was carried out for 5 minutes.
As the result, it was shown that the accumulations of ATPA which is the control are almost unchanged in the flower bud of the cytoplasmic male sterile rapeseed of 2 lines, fertility-restored raperapeseed, and the flower bud of the transformant rapeseed obtained by introducing DNA in the cytoplasmic male sterile line, but the accumulation of ORF125 protein was reduced significantly in the transformant rapeseed. A degree of this reduction is equal to that of the fertility-restored line obtained by transferring a fertility restorer gene to the cytoplasmic male sterile line by crossing (Fig. 4, and M. Iwabuchi et al. , Plant Molecular Biology (1999) 39: 183-188) . It was showed that the degree of reduction of ORF125 protein accumulation was 1/8 to 1/16 in fertility-restored raperapeseed and about 1/8 in the transformant rapeseed by comparison with the diluted series. As described above, the restoration of fertility in rapeseed strongly relates with the reduction of accumulation of ORF125 protein, and both means an identical sense. Therefore, it was demonstrated that the DNA sequence has a function of reducing the accumulation of ORF125 protein in the mitochondria and is a genome DNA sequence carrying the fertility restorer gene.
In addition, the pollen grains were taken out from the flowering plant and microscopically observed. As the result, it was confirmed that normal pollens were produced (fig. 5.)
Example 9: Isolation of cDNA.

Isolation of cDNA was carried out by selecting the F2 plant which has homozygous Rfl genes and shows pollen fertility, as an RNA donor from the F2 population used for preparation of the gene map, purifying mRNA from the flower bud, and then using 5'-RACE or 3'-RACE method after synthesis of the cDNA. (Purification of mRNA)
Total RNA was extracted from the flower bud of the F2 plant which has homozygous Rfl genes and shows pollen fertility, by applying guanidium thiocyanate method as an ordinary method by using RNeasy kit (Qiagen) . PolyA+RNA was purified from the total RNA using "mRNA Purification kit" (Amersham Pharmacia) using Origo (dT) cellulose column, and was used as mRNA. (Isolation of cDNA by 5'-RACE and 3'-RACE)
cDNA was isolated using 1 /i g of purified mRNA using "Marathon RACE system 5'RACE 3'RACE" kit based on 5'-RACE and 3'-RACE methods. As gene specific primers, 5'-GATTCCTTTCTCTTGCATTTCAG-3' (SEQ ID NO.10) was used for the 5'-RACE, and 5'-ATCTCGTCCTTTACCTTCTGTGG-3' (SEQ ID NO.11) was used for the 3'-RACE. After the nucleotide sequence of the obtained clone was determined, the sequence of the cDNA was obtained (SEQ ID N0.2).
Example 10: Conversion of cDNA to amino acid sequence, and analysis thereof
(1) Conversion of cDNA to the amino acid sequence was carried out using an ordinary genetic code and a gene analysis software "Genetyx-SV" (Software Development K.K.), resulting in obtaining the amino acid sequence of SEQ ID NO. 3 . The PPR motif was analyzed by employing a program registered in Protein Families Database of Alignments and HMNs (hereafter abbreviated to Pfam; http://www.Sanger.ac.uk/Software/Pfam/search.shtml) As the result of the analysis, it was found that the translated product of the fertility restorer gene of SEQ ID NO.l was the protein having 16 PPR motifs . The PPR motif has 3 PPR clusters . The 3 clusters were:

(1) PPR cluster #1: the PPR cluster composed of consecutive 175 residues of the first to fifth PPR motifs from the N terminal;
(2) PPR cluster #2 : the PPR cluster composed of consecutive 245 residues of the sixth to 12th PPR motifs from the N terminal ;and
(3) PPR cluster #3: the PPR cluster composed of consecutive 140 residues of the 13th to 16th PPR motifs from the N terminal.
Example 11: Analysis of the protein of the present invention
Itwas experimentedwhether or not translation is inhibited
in Escherichia coli by binding to the transcription product
(mRNA) of the gene of the protein ORF 125 causing Kosena cytoplasm male sterility.
The fertility restorer gene of SEQ ID NO. 2 was introduced into BamHl-Sphl site of the expression vector pQE-80L(Qiagen) of Escherichia coli to construct the expression vector which adds six histidine residues (6 x His) to the N terminal
(pQEBl/cds6) . DNA was amplified by using the primer: CGGGATCCGCTCACAATKSEQ ID NO.12) for introducing BaniHI site and M13 primer RV (Takara) and using pSTV29 (Takara) vector as a template. For DNA amplification, Takara LA PCR Kit (Takara) was used. The amplified DNA was cleaved by restriction enzymes Ba/nHI and EcoRI (Takara) , and then was purified by using Suprec-02 (Takara) . In order to synthesize a DNA fragment having Ba/nHI and EcoRI sites in both ends of 5'-UTR site of or f 125 gene and 25 amino acids of orfl25, PCR was carried out according to Fujimoto' method (Plant PCR Experiment Protocol: Practice of DNA synthesis. PP 84-87 (Syuuzyunsya)) using 2 primers. The 2 primers used were: 125-5'Ba/nHI:
GCGGATCCCAATTTCATTCTGCATCACTCTCCCTGTCGTTATCGACCTCGCAAGGTTTT TGAAACGGCCGAAACGGGAAGTGACAATACCGCTTTTCTTC (SEQ ID NO. 13) ; and
125-5'EcoRI :
GGAATTCACTAACTTTACATTCAGTAGGAGTGAGATTATGACAAAAAGTGGACAATTTT TCGAAAAAGGTAATCATGCATTTATATGCTGAAGAAAAGCG(SEQ ID NO.14).
The amplified DNA was cleaved with restriction enzymes

BamHI andEcoRI (Takara) andpurifiedby using Suprec-02 (Takara) . The purified DNAwas ligated using TaKaRa Ligation kit (Takara) , Escherichia coli DHIOB (Gibco BRL) was transformed therewith
and was cultured at 37°C for 18 hours or longer on LB agar medium (1% Bacto-Tryptone, 0.5% Bacto-Yeast Extract, 1% NaCl, 1.5%
Bacto-Agar, 0. ImM IPTG, 20μg/ml X-Gal) to which 50Mg/ml of chloramphenicol (Sigma) was added, Aplasmid was extracted from a pale blue colony by an ordinary method, and the nucleotide sequence was determined. Thus, a vector (pSTV125-5'#LA6) was constructed where 174bp (7th to 180th nucleotides of the nucleotide sequence of Fig. 6) containing 5'-UTRregion of orjfI25 gene and 25 amino acids of orfl25 was introduced between EcoRI site and a transcription-starting point of lacZ gene. Further simultaneously, the vector having the fragment (7th to 193th nucleotide of the nucleotide sequence of Fig. 6) in which several mutations occur in the portion corresponding to the 174 bp, was obtained (pSTV125-5'#LA12).
ThevectorspSTV125-5 '#LA6 and#LA.12 were each transferred to Escherichia coli DHIOB (Gibco BRL) , and the cells were standing-cultured on the agar medium obtained by adding 50 fi g/ml of chloramphenicol (Wako Pure Chemicals) , 200 ixM of IPTG (Wako Pure Chemicals) and 40 /i g/ml of X-Gal (Takara) toLBmedium, at 37 X^ overnight to grow the colony, resulting in pale blue colony. Thus, it was confirmed that that the transferred LacZ gene was expressed in Escherichia coli to which either vector was transferred.
In addition, in order to transfer the above pSTV125-5' vector and pQEBl/cds6 vector to the Escherichia coli which is same as that described above, when the cells were cultured using
the medium to which 50μg/ml of Ampicillin was added, in the case of co-cultureing with pSTV125-5'#LA6, the colony became white. However, in case of co-culturing with pSTV125-5'#LA12 having a mutation in a transfer fragment site, the colony became pale blue, and the degree of bluing was same as that of the case of #LA12 alone. Whether Escherichia coli lack any one of these

transferred vectors was examined by extracting the vectors by an ordinary method after culturing of each colony.
From the above results, it is understood that the protein expressed in Escherichia coli by pQEBl/cds6 vector became the white colony through suppression of expression of LacZ gene as the result of binding with mRNA of pSTV125-5 ' #LA6 . In case of co-culturing with pSTV125-5'#LA12, it is understood that mutation occurs in the transfer fragment site and thus, the protein derived from pQEBl/cds6 can not be bound to mRNA and as the result, LacZ gene is expressed to make blue.
Consequently, it is supposed that the protein having the amino acid sequence of SEQ ID NO. 3 influences mRNA of or f 125, more specifically the transcription product of a code region of at least orfI25-5'UTR region and 25 amino acid residues of ORF125 so as to suppress expression of the ORF125 protein.
It is presumed that the translation product of the gene of the present invention is, after translocated to the mitochondria, binds to the male sterile gene in the mitochondria to inhibit translation, resulting in reduction of the accumulation of the causal protein of cytoplasmic male sterility and thereby cytoplasmic male sterility is restored to fertility.
Example 12: Isolation of the fertility restorer gene of Kosena rapeseed
The genome sequence of the fertility restorer gene was obtained from the line of rapeseed (hereafter Kosena rapeseed) which was obtained by transferring the fertility restorer gene of Kosena radish by cell fusion, by applying PCR method. The DNA was extracted from 0.1 g of a leaf of Kosena rapeseed using DNA Isolation Kit (DNeasy plant mini) of Qiagen. In order to amplify the DNA, 5'-ACATAAAAATCACTAGATACTTGACATGGAGGC-3'(SEQ ID NO.30) which is the sequence of 1027bp to 1059bp nucleotide of SEQ ID NO.l, was designed as the forward primer and 5'-AAGAGGAGGAAGATGGCATCACAGC-3' (SEQ ID NO.31) which is the sequence of 7675 bp to 7651 bp nucleotide of SEQ ID NO.l, was

designed as the reverse primer.
To 10μ 1 of Kosena rapeseed DNA solution (50ng/μl) were added 49μl of sterilized water, 10 μ 1 of 10 x LA PCR buffer solution (Takara) , 10 μl of 25 mM MgCl2, 16 μ 1 of 2.5 mM dNTP mix, 2 M 1 of 10 μ M forward primer solution, 2 /i 1 of 10 μ M reverse primer solution, and 1 Μ 1 of 5 unit/μ 1 of TaKaRa LA Taq (Takara) , followed by mixing. DNA was amplified by repeating 30 times
a cycle of 98 °C for 20 seconds and 68 °C for 15 minutes. The thermal cycler used was UNOII (Biometra). After completion of the reaction, about 6 kb of the amplified product was purified using the ultrafiltration filter unit Microcon-PCR (Millipore) . The nucleotide sequence of 3306 bp of 4280th to 7585th nucleotide
of SEQ ID NO. 1 was determined by an ordinary method using the purified product as the template (SEQ ID NO. 15) . By comparison
of the genome nucleotide sequence obtained from Kosena rapeseed with the sequence obtained from Yuanhong radish, DNA nucleotide substitutions were found in 7bp among 3306bp, and it was revealed that they have a high homology.
Further, cDNA sequence of the fertility restorer gene of Kosena rapeseed at 3' part was obtained by RT-PCR, and it was confirmed that introns were spliced in the same manner as in Yuanhong radish. From the bud of Kosena rapeseed, the total RNA was extracted by AGPC (Acid Guanidium-Phenol-Chloroform) method (Syuuzyunsya. Cell Engineering Separate volume: Biotechnology Experiment Illustrated, (2) Fundamentals of gene
analysis: 161 to 166) which is an ordinary method. From 1μ
g of total RNA, cDNA was synthesized using SUPERSCRIPT II
RNaseH-Reverse Transcriptase (Invitrogen).
5'-TGGAGTAAAGAGGAACTAAAAAGGGC-3' (SEQ ID NO. 32) was used as the fertility restorer gene 3' part specific forward primer and 5'-CAGACAATAGACGCATAAAAGGC-3' (SEQ ID NO.33) was used as the fertility restorer gene 3' part specific reverse primer. The DNA was amplified by adding and mixing 14.9μil of sterilized water, 2.5 μ1 of 10 x PCR buffer solution (Takara) , 1.5μ 1 of 25 mM MgCl2, 2 μl of 2.5 mM dNTP mix, 1.5 μ1 of 10 μM forward

primer solution, 1.5 μ 1 of 10μM reverse primer solution and 0.1 M 1 of 5 unit/ M 1 TaKaRa Tag (Takara) to μ 1 of Kosena rapeseed cDNA solution and repeating 35 times a cycle of 94°C for 40 seconds, 60°C for 30 seconds and 72 °C for 2 minutes. The thermal cycler used was UNOII (Biometra) . To 3μ 1 of the amplified product were added 1μl of pGEM-Teasy vector (Promega), 5 μ 1 of 2 X ligation buffer solution (Promega) and 1μ1 of T4 DNA ligase (Promega), and the mixture was left standing at room temperature for 1 hour to ligate to the vector, Escherichia
coli DH5 a (Gibco BRL) was transformed with this vector to obtion a clone. The nucleotide sequence of the obtained clone was determined by an ordinary method, and it was confirmed that introns of the cDNA of Kosena rapeseed was spliced in the similar way as in Yuanhong radish. Thus, it was found that 7bp base substitutions found by the genome sequence comparison were present in 5444 bp to 5814 bp of SEQ ID NO. 1 and did not influence the splicing.
From the above results, it was found that the fertility restorer gene of Kosena rapeseed was expressed in the similar way as in Yuanhong radish. The sequence of cDNA which encodes only the translation region is shown in SEQ ID NO. 16. The amino acidsequence (SEQIDN0.17) was obtained from this cDNA sequence .
Example 13: Isolation of partial sequence of the fertility restorer gene of a wild radish, Raphanus raphanistrum (hereafter R. raphanistrum)
A partial sequence of the fertility restorer gene of R, raphanistrum was isolated from a cDNA. (Purification of mRNA)
Total RNA was extracted from the bud of R. raphanistrum byAGPC (AcidGuanidium-Phenol-Chloroform) method (Syuuzyunsya Cell Engineering Separate volume: Biotechnology Experiment Illustrated, (2) Fundamentals of gene analysis : 161 to 166) which is an ordinary method. PolyA+RNA was purified from total RNA using ""mRNA Purification kit" (Amersham Pharmacia) using Oligo

(dT) cellulose column, and was used as mRNA. (Isolation of the partial sequence of cDNA)
cDNA was synthesized from 1 μg of purified mRNA using "Marathon RACE system 5'RACE 3'RACE" kit (Clontech) .
5'-GATTCCTTTCTCTTGCATTTCAG-3' (SEQIDN0.34) was used as the fertility restorer gene specific forward primer and 5'-ATCTCGTCCTTTACCTTCTGTGG-3' (SEQ ID NO.35) was used as the fertility restorer gene specific reverse primer.
To 1 μl of R. raphanistrum cDNA solution were added 14.4 μ1 of sterilized water, 2.5 μ1 of 10 x Pyrobest PCR buffer solution (Takara) , 2 M 1 of 2 .5 mM dNTP mix, 2 . 5 μ 1 of 10 M M forwardprimer solution, 2 . 5 μ1 of 10 μ Mreverseprimer solution, and 0-1 μ 1 of 5 unit/μl of Pyrobest DNA polymerase (Takara) , followed by mixing. DNA was amplified by repeating 30 times
a cycle of 98oC for 5 seconds, 55oC for 30 seconds, and 72oC for 1 minute and 30 seconds. The thermal cycler used was UNOII
(Biometra) . 0.1/zl of 5 unit//il TaKaRa Tag (Takara) was added and mixed to the amplified DNA solution. Then, adenine nucleotide was added to 3' terminal of DNA by treatment of incubation at 72 °C for 10 minutes. To 3 ju 1 of the amplified product were added I/2I of pGEM-Teasy vector (Promega), 5 iU 1 of 2 X ligation buffer solution (Promega) and 1 ^u 1 of T4 DNA ligase (Promega), and the mixture was left standing at room temperature for an hour for ligation with the vector.
Escherichia coli DH5a (Gibco BRL) was transformed with this vector to obtain a clone. The nucleotide sequence of the obtained clone was determined by an ordinary method, and cDNA partial sequence was obtained (SEQ ID NO. 20) . Moreover, the amino acid sequence (SEQ ID NO. 21) was obtained from the cDNA sequence.
Example 14: Isolation of the fertility restorer gene of Ogura rapeseed
The cDNA sequence of the fertility restorer gene was isolated from the line of rapeseed which was obtained by transferring the f rtility restorer gene of Ogura radish by

crossing (hereafter Ogura rapeseed) , by applying 5'RACE method and 3'RACE method. (Purification of mRNA)
Total RNA was extracted from the flower buds of Ogura rapeseed by AGPC (Acid Guanidium-Phenol-Chloroform) method (Syuuzyunsya. Cell Engineering Separate volume: Biotechnology Experiment Illustrated, (2) Fundamentals of gene analysis: 161 to 166) which is an ordinary method. PolyA+RNA was purified using "mRNA Purification kit" (Amersham Pharmacia Corp. ) using Origo (dT) cellulose column, and was used as mRNA. (Isolation of the partial sequence of cDNA)
cDNA was synthesized from 1 ^g of purified mRNA using "Marathon RACE system 5'RACE 3'RACE" kit (Clontech). 5'-GATCCATGCATTTGTCAAGG-3' (SEQ ID NO. 36) was used as the fertility restorer gene specific forward primer and CATTTGTGTAGCCTCATCTAGG-3' (SEQ ID NO. 37) was used as the fertility restorer gene specific reverse primer.
To 1 μ 1 of Ogura rapeseed cDNA solution were added 14.4 μ1 of sterilized water, 2.5 μl of 10 x Pyrobest PCR buffer solution (Takara) , 2μl of 2.5 mM dNTP mix, 2.5/μ of 10 Μ M forward primer solution ,2.μlofl0μM reverse primer solution, and 0.1 /i 1 of 5 unit/jul of Pyrobest DNA polymerase (Takara), followed by mixing. DNA was amplified by repeating 30 times
a cycle of 98 X^ for 5 seconds, 55 °C for 30 seconds and 72C for 1 minute and 30 seconds. The thermal cycler used was UNOII
(Biometra) . 0 .1 μ 1 of 5 unit/ JJ. 1 TaKaRa Taq was added and mixed to the amplified DNA solution, then, adeninenucleotide was added
to 3' terminal of the DNA by treatment of incubation at 72°C for 10 minutes. To 3μ1 of the amplified product were added 1 μ 1 of pGEM-Teasy vector (Promega) , 5 μ 1 of 2 x ligation buffer solution (Promega) and 1μ 1 of T4 DNA ligase (Promega) , and the mixture was left standing at room temperature for 1 hour
to ligate with the vector. Escherichia coli DH5 a (Gibco BRL) was transformed with this vactor to obtain a clone. The nucleotide sequence of the obtained clone was determined by an

ordinary method, and four partial sequences of cDNA were obtained. On the basis of information of the obtained four partial sequences , primers were designed at four common parts for 5 'RACE and 3 'RACE, and each cDNA was isolated. {Isolation of cDNA by 5'RACE and 3'RACE)
cDNA was isolated in the same way as described above and performing 5'RACE and 3'RACE using 'Marathon RACE system 5'RACE 3'RACE" kit (Clontech) . As the gene specific primer, 5'-CATTTGTGTAGCCTCATCTAGG-3' (SEQ ID NO.37) and 5'-GTCCGGAGAGCAGCCCTTGGTAG-3'(SEQ ID NO.38) were used for 5'RACE, and 5'-TCATCGTATAATTCTTCAGCCTC-3'(SEQ ID NO.39) was used for 3'-RACE.
In 5'RACE, PCR was performed twice to obtain DNA. To 2 μ1 of an Ogura rapeseed cDNA solution which was diluted 250 times were added 8.6μ1 of sterilized water, 2μ 1 of 10 x LA PCR buffer solution (Takara) , 2μl of 25 mM MgCl2, 3.2μ 1 of 2.5mM dNTP mix, 1μ1 of 10 μ primer solution of SEQ IDNO.9907F, 1 M 1 of 10 jU M adapter primer solution (Marathon RACE system
5'RACE 3'RACE kit, Clontech) and 0.2 μ1 of 5 unit/M 1 TaKaRa LA Taq (Takara), followed by mixing. DNA was amplified by
repeating 5 times a cycle of 98 t for 5 seconds and 72 X^ for 3 minutes, 5 times a cycle at 98 °C for 5 seconds and 70 oC for 3 minutes, and 25 times a cycle of 98oC for 5 seconds and 68°C for 3 minutes . The obtained DNA solution was diluted 100 times ,
and to 2 μ 1 thereof were added 8.6 μ1 of sterilized water, 2 M 1 of 10 X LA PCR buffer solution (Takara) , 2μ 1 of 25 mM MgCl2, 3.2 μl of 2.5mM dNTP mix, 1 μ1 of 10μM primer solution of SEQ ID NO. 5' ogu-1, 1 M 1 of 10 μ M adapter primer solution (Marathon RACE system 5'RACE 3'RACE kit, Clontech) and 0.2 μ 1 of 5 unit/ μ 1 TaKaRa LA. Taq (Takara) , followed by mixing. DNA was amplified by repeating 5 times a cycle of 98 oC for 5 seconds and 72 °C for 3 minutes, 5 times a cycle of 98 °C for 5 seconds and 70 °C for 3 minutes , and 25 times a cycle of 98Cfor 5 seconds and 68 °C for 3 minutes. The thermal cycler used was UNOII (Biometra).


was left standing at room temperature for 1 hour to ligate with
the vector. Escherichia coli DH5 α (Gibco BRL) was transformed with this vector to obtain a clone. The nucleotide sequence of the obtained clone was determined, and then, 5'RACE sequence and 3'RACE sequence corresponding to the above 4 partial sequences of cDNA were obtained. The full length cDNA sequence was obtained by combinating each sequence. Among these, the sequence having the highest homology with cDNA sequence of Yuanhong radish was identified as the fertility restorer gene of Kosena rapeseed (SEQ ID NO-18). Further, the amino acid sequence (SEQ ID NO.19) was obtained from the cDNA.
Example 15: Analysis of the fertility restorer gene
For individual fertility restorer genes obtained by the above method, analyses were conducted by using an gene analysis software "Mac Vector 6.5" (Oxford Molecular Ltd.) for homology of the cDNA sequence and the amino acid sequence and by using Protein families database of alignments and HMNs usable in Sanger Institute, U. K. for motif analysis.
All of the Rf_ genes derived from Yuanhong radish, Kosena rapeseed and Ogura rapeseed according to the present invention have 16 PPR motifs, and these PPR motif groups are divided into 3 blocks of 5, 7, and 4 motifs from the amino terminal, and the

fourth amino acid located in the second PPR motif from the amino terminal was asparagine. The partial fragment derived from Raphanus raphanistrum was also analyzed by applying it to the corresponding part {94th to 264th of the SEQ ID NO. 26) of the above sequence, and as the result, it was found that it had a part corresponding to the first to sixth PPR motifs from the amino terminal, and the PPR motif groups and the fourth amino acid located in the second PPR motif from the amino terminal also showed the characteristics as described above.
Moreover, among 3 fertility restorer genes obtained from Yuanhong radish, Kosena rapeseed and Ogura rapeseed, and the protein (SEQ ID NO.26) and the gene encoding it (SEQ ID NO.27) of the present invention which were obtained by the result of the analysis of the partial sequence of the fertility restorer gene of R raphanistrum, Yuanhong radish shows very high homology with Kosena rapeseed. That is, the amino acid sequences show high homology value of 99.6% (only 3 amino acids are different) and the nucleotide sequences show high homology value of 99.7%. Therefore, the protein having an amino acid sequence of SEQ ID NO.29 and the gene (SEQ ID NO.25) encoding it are particularly preferred.
On the other hand, comparison of Ogura rapeseed with Yuanhong radish and Ogura rapeseed with Kosena rapeseed showed a high homology. Each homology in the amino acid sequence showed 92.0% in comparison of Ogura rapeseed with Yuanhong radish and 91. 6% in comparison of Ogura rapeseed with Kosena rapeseed. The comparison in the nucleotide sequence showed about 95% in both cases . These values are lower than thosebetween Yuanhong radish and Kosena rapeseed.
Industrial Applicability
According to the present invention , Rf gene, particularly the Rfl gene derived from radish was isolated and a structure thereof was determined. According to the present invention, a means for establishing a rapeseed fertility restorer line can

be provided using the isolated Rf gene




CLAIMS
1. A protein involved in restoration of a cytoplasmic male
sterile individual to fertility which has 14 or more
entatricopeptide repeat (hereafter may be abbreviated to PPR) motifs, wherein a group of the motifs is divided into 3 or more blocks, each of the individual blocks has at least 2 or more I'PR motifs, and the block in a carboxyl terminal (C terminal) side has 4 PPR motifs.
2. The protein of claim 1 wherein the number of PPR motifs Ls 14 to 16.
3. The protein of claim 1 or 2 wherein the PPR motif group Ls divided into 3 blocks and each block has 5,7, and 4 PPR motifs Ln the order from an amino terminal (N terminal).
4. The protein of any of claim 1 to 3 wherein the fourth amino acid located in a second PPR motif from the amino terminal (N terminal) is an amino acid other than serine, threonin and cysteine.
5 . The protein of claim 4 wherein the fourth amino acid located Ln a second PPR motif from the amino terminal (N terminal) is any one of asparagine, glutamine, aspartic acid, glutamic acid or histidine.
6. The protein of any of claims 1 to 5 which further has a signal peptide sequence to translocate to a mitochondria at the amino terminal or has a sequence of -LysAspGluLeu- at the carboxyl terminal.
7 . A protein involved in restoration of the cytoplasmic male sterile individual to fertility, which causes gel shift of a transcription product after contacting to the transcription product of a cytoplasmic male sterile gene.
8 . A protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence of SEQ ID NO.26.
9 . A protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence

of SEQ ID NO.27.
10 . A protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence of SEQ ID NO.28.
11. A protein involved in restoration of the cytoplasmic male sterile individual to fertility, which has an amino acid sequence of SEQ ID NO.29.
12. A protein of any of the followings:

(1) a protein having a sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 17, or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/or substituted, in the sequence from 80th to 687th amino acids of an amino acid sequence of SEQ ID NO. 3, the sequence from 80th to 687th amino acids of the amino acid sequence of SEQ ID NO. 17, or the sequence from 82nd to 690th amino acids of an amino acid sequence of SEQ ID NO. 19 , and is involved in restoration of the cytoplasmic male
sterile individual to fertilitv.
■A
13. A protein of any of the followings:
(1) a protein having an amino acid sequence of SEQ ID NO. 3, SEQ ID. 17, or SEQ ID NO.19; or
(2) a protein which has an amino acid sequence wherein 1 or a plurality of amino acids are deleted, added, and/ or substituted, in the amino acid sequence of SEQ ID NO. 3, SEQ ID NO. 17, or SEQ ID NO. 19, and is involved in restoration of the cytoplasmic male sterile individual to fertility.
14 . The protein of any of claims 1 to 9 wherein the cytoplasmic male sterile individual has a cytoplasmic male sterile gene of Kosena radish and/or Ogura radish or a homologue thereof.
15. A DNA encoding the protein of any of claims 1 to 10.
16. A DNA having a nucleotide sequence of SEQ ID NO.22.
17. A DNA having a nucleotide sequence of SEQ ID NO.23.

18. A DNA having a nucleotide sequence of SEQ ID NO.24,
19. A DNA having a nucleotide sequence of SEQ ID NO.25.
20. A DNA of any of the followings:
(1) a DNA having a nucleotide sequence of SEQ ID NO.2, SEQ ID
NO.16, or SEQ ID NO.18; or
(2) a DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/or substituted, in the nucleotide sequence of SEQ ID NO. 2, SEQ ID NO. 16, or SEQ ID NO. 18, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) a DNA which hybridizes with a DNA having a nucleotide sequence of SEQ ID NO. 2, SEQ ID NO. 16, and SEQ ID NO. 18 under a stringent condition and is involved in restoration of the cytoplasmic male sterile individual to fertility.
21. A DNA of any of the followings:
(1) a DNA having a sequence from 3754th to 8553th nucleotides of the nucleotide sequence of SEQ ID NO.1 or a sequence from 812th to 3002th nucleotides of the nucleotide sequence of SEQ ID NO.15; or
(2) a DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotide are deleted, added, and/or substituted, in the sequence from 3754th to 8553th nucleotides of the nucleotide sequence of SEQ ID NO.l, or a sequence from 812th to 3002th nucleotides of the nucleotide sequence of SEQ ID NO. 15, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) a DNA which hybridizes with a DNA having a sequence from
3754th to 8553th nucleotides of the nucleotide sequence of SEQ
ID NO.l or a sequence from 812th to 3002the nucleotides of the
nucleotide sequence of SEQ ID NO. 15 under a stringent condition,
and is involved in restoration of the cytoplasmic male sterile
individual to fertility.
22. A DNA of any of the followings:
(1) a DNA having a nucleotide sequences of SEQ ID NO.l or 15; or

(2) a DNA which has a nucleotide sequence wherein 1 or a plurality of nucleotides are deleted, added, and/or substituted in the nucleotide sequence of SEQ ID NO. 1 or SEQ ID NO. 15, and is involved in restoration of the cytoplasmic male sterile individual to fertility; or
(3) a DNA which hybridizes with a DNA having a nucleotide sequence of SEQ ID NO.l or SEQ ID NO. 15 under a stringent condition, and is involved in restoration of the cytoplasmic male sterile individual to fertility.

23. The DNA of any of claims 15 to 22 wherein the cytoplasmic male sterile individual has a cytoplasmic male sterile gene of Kosena radish and/or Ogura radish or a homologue thereof.
24. A vector containing DNA of any of claims 15 to 23.
25. A transformant having the DNA of any of claims 15 to 23 or the vector of claim 24,
26 . The transformant of claim 25 which is a transformed plant.
27. A method for the restoration of the cytoplasmic male sterile individual to fertility wherein DNA of any of claims 15 to 23 is used.
28. A transformant having a cytoplasmic male sterile gene wherein a partial or full length of DNA. of any of claims 15 to 23 is introduced with an induction type promoter to a cell having DNA of any of claims 15 to 23 , so that the transformant can regulate an expression of the cytoplasmic male sterile gene.
29. A method for maintaining the cytoplasmic male sterile line by using the transformant of claim 28.
30. A method for detecting a gene involved in restoration from the cytoplasmic male sterile, wherein 15 to 50mer oligonucleotide primer freely designed from the DNA of any of claims 15 to 23 or probe of at least 15 mer consisting of all or a part of the DNA of any of claims 15 to 23 is used, and the quantity of the nucleotide sequence amplified by the primer or the quantity of the nucleotide sequence detected by the probe in an organism sample of interest is confirmed to be 1 gene or more in a genome.

31. A promoter DNA having a sequence from 3754th to 5091th nucleotides of a nucleotide sequence of SEQ ID NO. 1 or a sequence from 1st to 811th nucleotides of a nucleotide sequence of SEQ ID NO.15.

32. A protein involved in restoration of a cytoplasmic male sterile individual to fertility substantially as herein described with reference to the accompanying drawings.
33. A promoter DNA substantially as herein described with reference to the accompanying drawings.


Documents:

1485-chenp-2003 abstract.pdf

1485-chenp-2003 claims granted.pdf

1485-chenp-2003 form 1.pdf

1485-chenp-2003 form 2.pdf

1485-chenp-2003 form 3.pdf

1485-chenp-2003 petition.pdf

1485-chenp-2003-abstract.pdf

1485-chenp-2003-assignement.pdf

1485-chenp-2003-claims.pdf

1485-chenp-2003-correspondnece-others.pdf

1485-chenp-2003-correspondnece-po.pdf

1485-chenp-2003-description(complete).pdf

1485-chenp-2003-drawings.pdf

1485-chenp-2003-form 1.pdf

1485-chenp-2003-form 26.pdf

1485-chenp-2003-form 3.pdf

1485-chenp-2003-form 5.pdf

1485-chenp-2003-form 6.pdf

1485-chenp-2003-pct.pdf


Patent Number 229161
Indian Patent Application Number 1485/CHENP/2003
PG Journal Number 12/2009
Publication Date 20-Mar-2009
Grant Date 13-Feb-2009
Date of Filing 22-Sep-2003
Name of Patentee INSTITUT NATIONAL DE LA RECHERCHE AGRONOMIQUE
Applicant Address 147, RUE DE 1'UNIVERSITE, F-75338 PARIS,
Inventors:
# Inventor's Name Inventor's Address
1 IMAMURA, JUN C/O. PLANTECH RESEARCH INSTITUTE, 1000, KAMOSHIDA-CHO, AOBA-KU, YOKOHAMA-SHI, KANAGAWA 227-0033,
2 FUJIMOTO, HIDEYA C/O. PLANTECH RESEARCH INSTITUTE, 1000, KAMOSHIDA-CHO, AOBA-KU, YOKOHAMA-SHI, KANAGAWA 227-0033,
3 IMAI, RITSUKO C/O. PLANTECH RESEARCH INSTITUTE, 1000, KAMOSHIDA-CHO, AOBA-KU, YOKOHAMA-SHI, KANAGAWA 227-0033,
4 KOIZUKA, NOBUYA C/O. PLANTECH RESEARCH INSTITUTE, 1000, KAMOSHIDA-CHO, AOBA-KU, YOKOHAMA-SHI, KANAGAWA 227-0033,
5 SAKAI, TAKAKO C/O. PLANTECH RESEARCH INSTITUTE, 1000, KAMOSHIDA-CHO, AOBA-KU, YOKOHAMA-SHI, KANAGAWA 227-0033,
6 HAYAKAWA, TAKAHIKO C/O. PLANTECH RESEARCH INSTITUTE, 1000, KAMOSHIDA-CHO, AOBA-KU, YOKOHAMA-SHI, KANAGAWA 227-0033,
PCT International Classification Number C07K14/415
PCT International Application Number PCT/JP02/04092
PCT International Filing date 2002-04-24
PCT Conventions:
# PCT Application Number Date of Convention Priority Country
1 2001-202082 2001-07-03 Japan
2 2001-128008 2001-04-25 Japan
3 2002-20083 2002-01-29 Japan